SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 223926.VP0804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223926.VP0804
Domain Number 1 Region: 113-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000131
Family NfeD domain-like 0.0063
Further Details:      
 
Weak hits

Sequence:  223926.VP0804
Domain Number - Region: 30-78
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00641
Family Glycerol-3-phosphate transporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 223926.VP0804
Sequence length 153
Comment (Vibrio parahaemolyticus)
Sequence
MDLFNLLDGITFWHWLAFGFVLLAVELLGTAGYFLWLGLSALLVGALLAVLPFGWQLQWL
SFATFSLLTTWLWWRRQWSRDKQDDQTRDLNQKYKQLIGRSVILEEDFSIGLNRIRIADT
TWSAQCEQNIRAGTRVKIVAIDGIILIVEPISE
Download sequence
Identical sequences A0A0D1EPH3 A0A0F6LQN8 A0A0M2IL77 A6B422 Q87RJ0
GO.2669 NP_797183.1.6614 WP_005454539.1.100929 WP_005454539.1.10139 WP_005454539.1.10142 WP_005454539.1.101585 WP_005454539.1.101665 WP_005454539.1.10531 WP_005454539.1.10999 WP_005454539.1.11583 WP_005454539.1.12658 WP_005454539.1.13548 WP_005454539.1.14243 WP_005454539.1.14638 WP_005454539.1.15211 WP_005454539.1.15258 WP_005454539.1.15563 WP_005454539.1.16073 WP_005454539.1.16503 WP_005454539.1.16742 WP_005454539.1.1836 WP_005454539.1.18767 WP_005454539.1.19074 WP_005454539.1.19755 WP_005454539.1.20587 WP_005454539.1.21130 WP_005454539.1.22008 WP_005454539.1.22207 WP_005454539.1.22509 WP_005454539.1.22854 WP_005454539.1.22951 WP_005454539.1.23592 WP_005454539.1.23858 WP_005454539.1.23893 WP_005454539.1.24073 WP_005454539.1.24866 WP_005454539.1.25390 WP_005454539.1.26080 WP_005454539.1.26245 WP_005454539.1.264 WP_005454539.1.26541 WP_005454539.1.2670 WP_005454539.1.26729 WP_005454539.1.26889 WP_005454539.1.27000 WP_005454539.1.27385 WP_005454539.1.2908 WP_005454539.1.29832 WP_005454539.1.29928 WP_005454539.1.30198 WP_005454539.1.30244 WP_005454539.1.30327 WP_005454539.1.31961 WP_005454539.1.31998 WP_005454539.1.32539 WP_005454539.1.330 WP_005454539.1.33537 WP_005454539.1.3431 WP_005454539.1.35169 WP_005454539.1.35351 WP_005454539.1.35596 WP_005454539.1.35751 WP_005454539.1.36706 WP_005454539.1.36788 WP_005454539.1.37148 WP_005454539.1.37683 WP_005454539.1.38010 WP_005454539.1.38739 WP_005454539.1.39 WP_005454539.1.39142 WP_005454539.1.39181 WP_005454539.1.39379 WP_005454539.1.3940 WP_005454539.1.3961 WP_005454539.1.39756 WP_005454539.1.39791 WP_005454539.1.39826 WP_005454539.1.39842 WP_005454539.1.3995 WP_005454539.1.41418 WP_005454539.1.42776 WP_005454539.1.42858 WP_005454539.1.43185 WP_005454539.1.43895 WP_005454539.1.4519 WP_005454539.1.45564 WP_005454539.1.45633 WP_005454539.1.46057 WP_005454539.1.47040 WP_005454539.1.4734 WP_005454539.1.47510 WP_005454539.1.47809 WP_005454539.1.48035 WP_005454539.1.4861 WP_005454539.1.48612 WP_005454539.1.4902 WP_005454539.1.49285 WP_005454539.1.49432 WP_005454539.1.49920 WP_005454539.1.50206 WP_005454539.1.5033 WP_005454539.1.50640 WP_005454539.1.50833 WP_005454539.1.51945 WP_005454539.1.52959 WP_005454539.1.53064 WP_005454539.1.53114 WP_005454539.1.53207 WP_005454539.1.5332 WP_005454539.1.53943 WP_005454539.1.54059 WP_005454539.1.54719 WP_005454539.1.55108 WP_005454539.1.55354 WP_005454539.1.55855 WP_005454539.1.5595 WP_005454539.1.56068 WP_005454539.1.56836 WP_005454539.1.56842 WP_005454539.1.57128 WP_005454539.1.57129 WP_005454539.1.57332 WP_005454539.1.5768 WP_005454539.1.57934 WP_005454539.1.58273 WP_005454539.1.58791 WP_005454539.1.5882 WP_005454539.1.59528 WP_005454539.1.5962 WP_005454539.1.59650 WP_005454539.1.59786 WP_005454539.1.59887 WP_005454539.1.59926 WP_005454539.1.60089 WP_005454539.1.60172 WP_005454539.1.606 WP_005454539.1.61129 WP_005454539.1.61745 WP_005454539.1.61795 WP_005454539.1.61892 WP_005454539.1.62401 WP_005454539.1.6274 WP_005454539.1.62759 WP_005454539.1.63316 WP_005454539.1.63829 WP_005454539.1.6404 WP_005454539.1.64057 WP_005454539.1.64243 WP_005454539.1.65106 WP_005454539.1.65279 WP_005454539.1.66018 WP_005454539.1.66030 WP_005454539.1.66211 WP_005454539.1.66844 WP_005454539.1.66850 WP_005454539.1.67995 WP_005454539.1.69119 WP_005454539.1.69352 WP_005454539.1.70848 WP_005454539.1.71210 WP_005454539.1.71278 WP_005454539.1.71559 WP_005454539.1.71997 WP_005454539.1.73712 WP_005454539.1.74480 WP_005454539.1.74603 WP_005454539.1.74813 WP_005454539.1.75461 WP_005454539.1.75707 WP_005454539.1.77954 WP_005454539.1.78237 WP_005454539.1.78886 WP_005454539.1.78935 WP_005454539.1.79694 WP_005454539.1.80241 WP_005454539.1.81454 WP_005454539.1.81537 WP_005454539.1.81752 WP_005454539.1.81753 WP_005454539.1.81782 WP_005454539.1.81805 WP_005454539.1.81887 WP_005454539.1.81992 WP_005454539.1.82387 WP_005454539.1.82791 WP_005454539.1.83010 WP_005454539.1.83411 WP_005454539.1.8373 WP_005454539.1.84036 WP_005454539.1.84073 WP_005454539.1.843 WP_005454539.1.85334 WP_005454539.1.86416 WP_005454539.1.86700 WP_005454539.1.88044 WP_005454539.1.88312 WP_005454539.1.88333 WP_005454539.1.88760 WP_005454539.1.89152 WP_005454539.1.89749 WP_005454539.1.90016 WP_005454539.1.90588 WP_005454539.1.91910 WP_005454539.1.92596 WP_005454539.1.92816 WP_005454539.1.93458 WP_005454539.1.93476 WP_005454539.1.93964 WP_005454539.1.93996 WP_005454539.1.94697 WP_005454539.1.94882 WP_005454539.1.9499 WP_005454539.1.95872 WP_005454539.1.96237 WP_005454539.1.96264 WP_005454539.1.9642 WP_005454539.1.96444 WP_005454539.1.96491 WP_005454539.1.97299 WP_005454539.1.97950 WP_005454539.1.99239 WP_005454539.1.99325 WP_005454539.1.9933 WP_005454539.1.99805 gi|28897578|ref|NP_797183.1| 223926.VP0804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]