SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 223926.VP0932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223926.VP0932
Domain Number 1 Region: 106-321
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.43e-47
Family D-glucarate dehydratase-like 0.000000542
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-25
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 223926.VP0932
Sequence length 329
Comment (Vibrio parahaemolyticus)
Sequence
MRKAKIYRYCLPMDSGVILRDNKLTERIGYIVELSDGENTGLGEVAPLFGFSLESTEEAG
IQLQEQAERWVAGIPVDYANMYPSVAFGLSMAQLELEGGLPTQGKYQTAPLCTGDPDELI
PKLNEMDGEKVAKVKVGLYEPIRDGMLVNLFLESIPQLTLRLDANRAWTPEKAQQFAKYI
TPSLRQRITFLEEPCRAPGDSMSFAINTGIAIAWDETLQDAVRREDFSLEDLTGVKAIII
KPTLIGSVDFCIKLIEKAKALGMKAVISSSIESSLGLNQLARLAQWQLPDEVPGLDTIGL
FKAQLEQGWPKCELPVLPLSEQELVWHSA
Download sequence
Identical sequences A0A072GGL6 A0A0F6LQZ1 Q87R66 Z2ENA1
NP_797311.1.6614 WP_005482548.1.10142 WP_005482548.1.101585 WP_005482548.1.10999 WP_005482548.1.14243 WP_005482548.1.15211 WP_005482548.1.15563 WP_005482548.1.16073 WP_005482548.1.16503 WP_005482548.1.16742 WP_005482548.1.1836 WP_005482548.1.19074 WP_005482548.1.19755 WP_005482548.1.20587 WP_005482548.1.21130 WP_005482548.1.22008 WP_005482548.1.22854 WP_005482548.1.22951 WP_005482548.1.24866 WP_005482548.1.25390 WP_005482548.1.26080 WP_005482548.1.26245 WP_005482548.1.264 WP_005482548.1.27000 WP_005482548.1.29928 WP_005482548.1.31998 WP_005482548.1.35351 WP_005482548.1.35596 WP_005482548.1.35751 WP_005482548.1.36788 WP_005482548.1.37148 WP_005482548.1.37683 WP_005482548.1.39 WP_005482548.1.39142 WP_005482548.1.39379 WP_005482548.1.3961 WP_005482548.1.39756 WP_005482548.1.39842 WP_005482548.1.42776 WP_005482548.1.42858 WP_005482548.1.43185 WP_005482548.1.43895 WP_005482548.1.45633 WP_005482548.1.46057 WP_005482548.1.4734 WP_005482548.1.47510 WP_005482548.1.48035 WP_005482548.1.4861 WP_005482548.1.48612 WP_005482548.1.4902 WP_005482548.1.49432 WP_005482548.1.49920 WP_005482548.1.5033 WP_005482548.1.50640 WP_005482548.1.50833 WP_005482548.1.51945 WP_005482548.1.52959 WP_005482548.1.53064 WP_005482548.1.53207 WP_005482548.1.53943 WP_005482548.1.54059 WP_005482548.1.55108 WP_005482548.1.55354 WP_005482548.1.5595 WP_005482548.1.56068 WP_005482548.1.56836 WP_005482548.1.56842 WP_005482548.1.57129 WP_005482548.1.57332 WP_005482548.1.5768 WP_005482548.1.58791 WP_005482548.1.5962 WP_005482548.1.59786 WP_005482548.1.59887 WP_005482548.1.60089 WP_005482548.1.60172 WP_005482548.1.606 WP_005482548.1.61129 WP_005482548.1.61745 WP_005482548.1.62401 WP_005482548.1.6274 WP_005482548.1.63316 WP_005482548.1.6404 WP_005482548.1.65279 WP_005482548.1.66211 WP_005482548.1.66850 WP_005482548.1.71278 WP_005482548.1.71997 WP_005482548.1.73171 WP_005482548.1.73712 WP_005482548.1.74603 WP_005482548.1.74813 WP_005482548.1.75461 WP_005482548.1.79694 WP_005482548.1.81752 WP_005482548.1.81782 WP_005482548.1.81805 WP_005482548.1.81887 WP_005482548.1.82387 WP_005482548.1.82791 WP_005482548.1.8373 WP_005482548.1.84036 WP_005482548.1.86416 WP_005482548.1.86700 WP_005482548.1.88312 WP_005482548.1.90588 WP_005482548.1.91910 WP_005482548.1.92596 WP_005482548.1.92816 WP_005482548.1.93458 WP_005482548.1.94697 WP_005482548.1.96237 WP_005482548.1.96264 WP_005482548.1.9642 WP_005482548.1.96491 WP_005482548.1.99805 223926.VP0932 gi|28897706|ref|NP_797311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]