SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 223926.VP2063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223926.VP2063
Domain Number 1 Region: 416-498
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 223926.VP2063
Sequence length 519
Comment (Vibrio parahaemolyticus)
Sequence
MFEFPQFSKHSIKNDVLSGLTVALALVPEAVAFAFVAGVDPMVGLYAAFIVGLITSIFGG
RPGMISGATGAMAVVMVSLVASHGVQYLFAAIMLAGILQIAAGLFKLGKFIRIVPHPVMI
GFVNGLAIVIFLAQLGQFKAPDINGVLTWLPQDQMMLMLGLVALTMAIIYFLPKITTAVP
SSLVAIVTVTALVVGLDLETRTVVDFLRSMSGNEAATLAGSLPTFSIPSVPFTLETLQII
LPYAVILAAIGLIESLLTLTVLDEMTNTRGQSNRECIGQGMANMTCSVFGAMGGCAMIGQ
SMINVNSGGRGRLSGIVAAVALLMFILFASSLIEMIPLAALVGVMFMVVIGTFEWATFKL
ARRVPKQDFFVIVLVTVVTVLTDLAVAVAVGVIASALMFAWQHAKHIYADTCLNAEGSKE
YKIHGPIFFGSAANFLELFNAPEDPKDVIVDFADSRVTDHSAIEAIETLAERYASIGKTL
HLRHLSPDCRKLLDKAGSLVEINVKEDPSYKVATDILAG
Download sequence
Identical sequences A0A0D1ESR1 A0A0F6LV29 A0A0L8SH76 A0A2H1B614 Q87N13 S5IMA2 Z2EYS9
223926.VP2063 GO.9026 gi|433658164|ref|YP_007275543.1| gi|28898837|ref|NP_798442.1| NP_798442.1.6614 WP_005482406.1.100407 WP_005482406.1.100929 WP_005482406.1.10142 WP_005482406.1.101585 WP_005482406.1.102137 WP_005482406.1.10531 WP_005482406.1.10550 WP_005482406.1.10999 WP_005482406.1.11219 WP_005482406.1.11583 WP_005482406.1.12227 WP_005482406.1.12343 WP_005482406.1.14243 WP_005482406.1.14638 WP_005482406.1.15419 WP_005482406.1.15563 WP_005482406.1.16073 WP_005482406.1.16503 WP_005482406.1.16742 WP_005482406.1.17941 WP_005482406.1.1836 WP_005482406.1.19074 WP_005482406.1.19755 WP_005482406.1.1977 WP_005482406.1.20403 WP_005482406.1.20587 WP_005482406.1.21130 WP_005482406.1.21927 WP_005482406.1.22008 WP_005482406.1.22854 WP_005482406.1.22951 WP_005482406.1.23232 WP_005482406.1.23893 WP_005482406.1.24866 WP_005482406.1.2532 WP_005482406.1.25390 WP_005482406.1.26245 WP_005482406.1.264 WP_005482406.1.26729 WP_005482406.1.26889 WP_005482406.1.27000 WP_005482406.1.27256 WP_005482406.1.27385 WP_005482406.1.29784 WP_005482406.1.29928 WP_005482406.1.30244 WP_005482406.1.31628 WP_005482406.1.31746 WP_005482406.1.31998 WP_005482406.1.32539 WP_005482406.1.35351 WP_005482406.1.35596 WP_005482406.1.35751 WP_005482406.1.35973 WP_005482406.1.36619 WP_005482406.1.36788 WP_005482406.1.37148 WP_005482406.1.37683 WP_005482406.1.39 WP_005482406.1.39142 WP_005482406.1.39379 WP_005482406.1.3961 WP_005482406.1.39756 WP_005482406.1.39842 WP_005482406.1.40386 WP_005482406.1.40625 WP_005482406.1.41224 WP_005482406.1.42776 WP_005482406.1.42858 WP_005482406.1.43185 WP_005482406.1.43895 WP_005482406.1.45009 WP_005482406.1.45633 WP_005482406.1.45978 WP_005482406.1.46057 WP_005482406.1.47040 WP_005482406.1.4734 WP_005482406.1.47510 WP_005482406.1.48035 WP_005482406.1.4861 WP_005482406.1.48612 WP_005482406.1.4866 WP_005482406.1.4902 WP_005482406.1.49285 WP_005482406.1.49356 WP_005482406.1.49432 WP_005482406.1.49920 WP_005482406.1.50640 WP_005482406.1.50833 WP_005482406.1.51431 WP_005482406.1.51945 WP_005482406.1.52959 WP_005482406.1.53207 WP_005482406.1.53943 WP_005482406.1.54059 WP_005482406.1.54719 WP_005482406.1.55108 WP_005482406.1.55354 WP_005482406.1.55548 WP_005482406.1.55759 WP_005482406.1.5595 WP_005482406.1.56068 WP_005482406.1.56836 WP_005482406.1.56842 WP_005482406.1.57129 WP_005482406.1.57332 WP_005482406.1.5768 WP_005482406.1.57773 WP_005482406.1.58356 WP_005482406.1.58791 WP_005482406.1.5882 WP_005482406.1.5962 WP_005482406.1.59887 WP_005482406.1.60089 WP_005482406.1.60172 WP_005482406.1.606 WP_005482406.1.60660 WP_005482406.1.61129 WP_005482406.1.61311 WP_005482406.1.61745 WP_005482406.1.61756 WP_005482406.1.61892 WP_005482406.1.62401 WP_005482406.1.6274 WP_005482406.1.62759 WP_005482406.1.63680 WP_005482406.1.6404 WP_005482406.1.64445 WP_005482406.1.65106 WP_005482406.1.65279 WP_005482406.1.65345 WP_005482406.1.6611 WP_005482406.1.66211 WP_005482406.1.6652 WP_005482406.1.66844 WP_005482406.1.66850 WP_005482406.1.71164 WP_005482406.1.71278 WP_005482406.1.71594 WP_005482406.1.71657 WP_005482406.1.71997 WP_005482406.1.7318 WP_005482406.1.73712 WP_005482406.1.73877 WP_005482406.1.74480 WP_005482406.1.74603 WP_005482406.1.74721 WP_005482406.1.74813 WP_005482406.1.75461 WP_005482406.1.75707 WP_005482406.1.76187 WP_005482406.1.78137 WP_005482406.1.78964 WP_005482406.1.79694 WP_005482406.1.79702 WP_005482406.1.81752 WP_005482406.1.81782 WP_005482406.1.81805 WP_005482406.1.81887 WP_005482406.1.82387 WP_005482406.1.82791 WP_005482406.1.83411 WP_005482406.1.83603 WP_005482406.1.8373 WP_005482406.1.84036 WP_005482406.1.85122 WP_005482406.1.85505 WP_005482406.1.86199 WP_005482406.1.86416 WP_005482406.1.8650 WP_005482406.1.86700 WP_005482406.1.88312 WP_005482406.1.89256 WP_005482406.1.90588 WP_005482406.1.90807 WP_005482406.1.90891 WP_005482406.1.91108 WP_005482406.1.91910 WP_005482406.1.92596 WP_005482406.1.92787 WP_005482406.1.92816 WP_005482406.1.93458 WP_005482406.1.93964 WP_005482406.1.95057 WP_005482406.1.95160 WP_005482406.1.95705 WP_005482406.1.96237 WP_005482406.1.96264 WP_005482406.1.9642 WP_005482406.1.96491 WP_005482406.1.97950 WP_005482406.1.99805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]