SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 223926.VP2290 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223926.VP2290
Domain Number 1 Region: 450-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 223926.VP2290
Sequence length 591
Comment (Vibrio parahaemolyticus)
Sequence
MENLLARLLFAQWFPGLIQLKNYQKEWLVNDFRAAFSVVAVALPVAIAYAQLTGVSAIVG
LYSCVLPMLVYALMGTSRQLIVGPDAATCAVIAAVVTPIAAGDPTKHWQLVMTMTAMTGI
WCVLASRFKLGIFADFLSRPILLGLLNGVALTIIVGQFAKVVGLKYEQRYLLERLWEAPQ
RLAELHWPTVALSVATVVVYLVTKRYRPTWPAAMLAILVTTASVWLLHLQEMDVAVVGLT
QGGFPQFQAPQFELGEVRELVVPALNLAIVSFVSMMLTARSFAAKNGYDIDANKEFQALG
FANIASAFSQGFAISGADSRTAVNDANGGKSQLVSIVAAITIAIIAVFIYEPLQFIPIAS
LGVVLIIASLSLLDLKAIWILKTRDKDAFYLAIITFISVLVIGVIPGITLAVLLGLFQFL
RIVMRPSDQLLGLDEKGTIRTIDETGKASPIPGMVIYRFNSPLTYFNAPYFKRRLLEHAE
QNKDVSCVVVDAVSSFTHLDLSVMATLADIHEVLKKRGIRLVLAGRKRRLRQWCELTGIS
TSEGGILLRADMYLAIKLSGSYLSAVGEGIVPTVQKEPDLEQPPKPIPEVA
Download sequence
Identical sequences A0A0F6LTY8 A0A0M0DSK6 A0A2H1B432 A6B055 Q87MG5 X7RAW2
GO.9028 NP_798669.1.6614 WP_005457639.1.100373 WP_005457639.1.100494 WP_005457639.1.100929 WP_005457639.1.10142 WP_005457639.1.101469 WP_005457639.1.101501 WP_005457639.1.101585 WP_005457639.1.10531 WP_005457639.1.10550 WP_005457639.1.10999 WP_005457639.1.11219 WP_005457639.1.11352 WP_005457639.1.12087 WP_005457639.1.12227 WP_005457639.1.12343 WP_005457639.1.12539 WP_005457639.1.12658 WP_005457639.1.130 WP_005457639.1.13482 WP_005457639.1.13548 WP_005457639.1.14638 WP_005457639.1.15211 WP_005457639.1.15258 WP_005457639.1.15563 WP_005457639.1.16021 WP_005457639.1.16503 WP_005457639.1.16742 WP_005457639.1.17941 WP_005457639.1.19074 WP_005457639.1.19108 WP_005457639.1.19647 WP_005457639.1.19755 WP_005457639.1.20587 WP_005457639.1.21130 WP_005457639.1.21927 WP_005457639.1.22008 WP_005457639.1.22207 WP_005457639.1.22509 WP_005457639.1.22854 WP_005457639.1.22951 WP_005457639.1.23232 WP_005457639.1.23585 WP_005457639.1.23592 WP_005457639.1.23893 WP_005457639.1.24639 WP_005457639.1.24866 WP_005457639.1.2532 WP_005457639.1.25353 WP_005457639.1.25390 WP_005457639.1.25436 WP_005457639.1.25529 WP_005457639.1.26245 WP_005457639.1.264 WP_005457639.1.26541 WP_005457639.1.2670 WP_005457639.1.26729 WP_005457639.1.26889 WP_005457639.1.27000 WP_005457639.1.27116 WP_005457639.1.27256 WP_005457639.1.2846 WP_005457639.1.28926 WP_005457639.1.29398 WP_005457639.1.29832 WP_005457639.1.29928 WP_005457639.1.29975 WP_005457639.1.30764 WP_005457639.1.31179 WP_005457639.1.3137 WP_005457639.1.31722 WP_005457639.1.31746 WP_005457639.1.31829 WP_005457639.1.31998 WP_005457639.1.32539 WP_005457639.1.33209 WP_005457639.1.34116 WP_005457639.1.3423 WP_005457639.1.34442 WP_005457639.1.34806 WP_005457639.1.34889 WP_005457639.1.35351 WP_005457639.1.35596 WP_005457639.1.35751 WP_005457639.1.35973 WP_005457639.1.36558 WP_005457639.1.36623 WP_005457639.1.36788 WP_005457639.1.37683 WP_005457639.1.37812 WP_005457639.1.37931 WP_005457639.1.38010 WP_005457639.1.38739 WP_005457639.1.39 WP_005457639.1.39142 WP_005457639.1.39181 WP_005457639.1.39379 WP_005457639.1.3961 WP_005457639.1.39756 WP_005457639.1.39826 WP_005457639.1.39842 WP_005457639.1.3995 WP_005457639.1.39977 WP_005457639.1.40273 WP_005457639.1.40684 WP_005457639.1.4076 WP_005457639.1.41441 WP_005457639.1.42292 WP_005457639.1.42776 WP_005457639.1.42858 WP_005457639.1.42872 WP_005457639.1.43185 WP_005457639.1.43895 WP_005457639.1.44787 WP_005457639.1.44988 WP_005457639.1.4519 WP_005457639.1.45334 WP_005457639.1.45497 WP_005457639.1.45633 WP_005457639.1.45978 WP_005457639.1.46057 WP_005457639.1.46735 WP_005457639.1.47040 WP_005457639.1.4734 WP_005457639.1.47510 WP_005457639.1.48035 WP_005457639.1.48559 WP_005457639.1.4861 WP_005457639.1.48612 WP_005457639.1.48866 WP_005457639.1.4902 WP_005457639.1.49285 WP_005457639.1.49432 WP_005457639.1.49920 WP_005457639.1.50114 WP_005457639.1.50206 WP_005457639.1.5033 WP_005457639.1.50640 WP_005457639.1.50644 WP_005457639.1.50654 WP_005457639.1.50687 WP_005457639.1.50833 WP_005457639.1.51017 WP_005457639.1.51258 WP_005457639.1.51827 WP_005457639.1.51945 WP_005457639.1.52124 WP_005457639.1.52739 WP_005457639.1.52959 WP_005457639.1.53064 WP_005457639.1.5332 WP_005457639.1.53702 WP_005457639.1.53943 WP_005457639.1.54083 WP_005457639.1.54295 WP_005457639.1.54608 WP_005457639.1.5471 WP_005457639.1.55108 WP_005457639.1.55429 WP_005457639.1.55435 WP_005457639.1.5595 WP_005457639.1.56068 WP_005457639.1.56677 WP_005457639.1.56836 WP_005457639.1.56842 WP_005457639.1.57128 WP_005457639.1.57129 WP_005457639.1.57390 WP_005457639.1.5768 WP_005457639.1.57934 WP_005457639.1.58273 WP_005457639.1.58791 WP_005457639.1.5962 WP_005457639.1.59650 WP_005457639.1.59786 WP_005457639.1.59887 WP_005457639.1.60089 WP_005457639.1.60660 WP_005457639.1.61129 WP_005457639.1.61311 WP_005457639.1.61745 WP_005457639.1.62401 WP_005457639.1.6274 WP_005457639.1.63301 WP_005457639.1.63752 WP_005457639.1.63829 WP_005457639.1.6404 WP_005457639.1.64393 WP_005457639.1.64445 WP_005457639.1.65106 WP_005457639.1.65123 WP_005457639.1.65279 WP_005457639.1.65429 WP_005457639.1.65524 WP_005457639.1.66018 WP_005457639.1.66211 WP_005457639.1.66438 WP_005457639.1.6652 WP_005457639.1.6655 WP_005457639.1.66850 WP_005457639.1.66874 WP_005457639.1.68046 WP_005457639.1.69119 WP_005457639.1.69352 WP_005457639.1.69768 WP_005457639.1.69837 WP_005457639.1.70381 WP_005457639.1.70848 WP_005457639.1.71087 WP_005457639.1.71164 WP_005457639.1.71278 WP_005457639.1.71594 WP_005457639.1.71850 WP_005457639.1.72063 WP_005457639.1.7283 WP_005457639.1.72989 WP_005457639.1.73113 WP_005457639.1.7370 WP_005457639.1.74319 WP_005457639.1.74455 WP_005457639.1.74603 WP_005457639.1.74721 WP_005457639.1.74737 WP_005457639.1.74813 WP_005457639.1.75461 WP_005457639.1.76318 WP_005457639.1.76704 WP_005457639.1.76725 WP_005457639.1.76917 WP_005457639.1.77412 WP_005457639.1.78137 WP_005457639.1.78237 WP_005457639.1.78619 WP_005457639.1.78624 WP_005457639.1.78886 WP_005457639.1.78935 WP_005457639.1.78964 WP_005457639.1.79225 WP_005457639.1.79694 WP_005457639.1.7976 WP_005457639.1.8069 WP_005457639.1.81050 WP_005457639.1.81205 WP_005457639.1.81334 WP_005457639.1.81752 WP_005457639.1.81782 WP_005457639.1.81887 WP_005457639.1.81998 WP_005457639.1.82387 WP_005457639.1.82791 WP_005457639.1.82801 WP_005457639.1.83326 WP_005457639.1.83659 WP_005457639.1.8373 WP_005457639.1.83742 WP_005457639.1.84036 WP_005457639.1.84073 WP_005457639.1.843 WP_005457639.1.84344 WP_005457639.1.84362 WP_005457639.1.84957 WP_005457639.1.85122 WP_005457639.1.85177 WP_005457639.1.8531 WP_005457639.1.85334 WP_005457639.1.85417 WP_005457639.1.8543 WP_005457639.1.85505 WP_005457639.1.85687 WP_005457639.1.86199 WP_005457639.1.86416 WP_005457639.1.8694 WP_005457639.1.8729 WP_005457639.1.87787 WP_005457639.1.88312 WP_005457639.1.88333 WP_005457639.1.8839 WP_005457639.1.88511 WP_005457639.1.88668 WP_005457639.1.90016 WP_005457639.1.90588 WP_005457639.1.90807 WP_005457639.1.91108 WP_005457639.1.91202 WP_005457639.1.91910 WP_005457639.1.92553 WP_005457639.1.92596 WP_005457639.1.92816 WP_005457639.1.93195 WP_005457639.1.93458 WP_005457639.1.93460 WP_005457639.1.93476 WP_005457639.1.9390 WP_005457639.1.9498 WP_005457639.1.9499 WP_005457639.1.95160 WP_005457639.1.96237 WP_005457639.1.96264 WP_005457639.1.9642 WP_005457639.1.96491 WP_005457639.1.96723 WP_005457639.1.97299 WP_005457639.1.97811 WP_005457639.1.97950 WP_005457639.1.98496 WP_005457639.1.98507 WP_005457639.1.99239 WP_005457639.1.99325 WP_005457639.1.9933 WP_005457639.1.99805 WP_005457639.1.99875 223926.VP2290 gi|28899064|ref|NP_798669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]