SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 223926.VPA1105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223926.VPA1105
Domain Number 1 Region: 10-127,155-216
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.39e-27
Family Clp protease, ClpP subunit 0.035
Further Details:      
 
Domain Number 2 Region: 389-453
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000017
Family NfeD domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 223926.VPA1105
Sequence length 459
Comment (Vibrio parahaemolyticus)
Sequence
MKRTWIWLLPLLLFAGQTLANTVWIVPVKGAIGPANSDYLTREIEQAQINGVSLVILKMD
TPGGLDSAMRDIIHAITTSTTPIATWVGPSGSRAASAGTYILLASHVAAMAEATNLGAAT
PVAIGGAPQAPSSDDGKDKEASDENKPNAEKSGDQVPAKTAMEKKVINDAKAYIKGLAKL
HDRNAQWAEKAVSEAASLDAEEALELNVIDVIANSPEELVTAINGKSVKVNNLPVTLSLD
NPIWVERTPDWRAEMLAVITNPNVAYILMLIGIYGLLLEFYNPGVGLPGVLGGICLLLAM
YALQMMPVNYAGLGLLLLGIALMIAEAFSPSFGILGLGGVVAFVLGSIFLMDSELPGFQI
ALPLIFGIAIFSIALILLTIGFLLRIRGKGVTTGLETYPGKHAVVSDDFIDGQGRVQFEG
AFWQAKTEQDQELKQGESVTIVHVKGLTLTVKPNDRPKE
Download sequence
Identical sequences A0A0F6LL39 A0A0L8TWR9 Q87H60
NP_800615.1.6614 WP_005477226.1.101585 WP_005477226.1.10999 WP_005477226.1.14243 WP_005477226.1.15211 WP_005477226.1.15563 WP_005477226.1.16503 WP_005477226.1.16742 WP_005477226.1.1836 WP_005477226.1.19074 WP_005477226.1.19755 WP_005477226.1.20587 WP_005477226.1.21130 WP_005477226.1.22008 WP_005477226.1.22854 WP_005477226.1.22951 WP_005477226.1.24866 WP_005477226.1.25390 WP_005477226.1.26080 WP_005477226.1.26245 WP_005477226.1.264 WP_005477226.1.26729 WP_005477226.1.27000 WP_005477226.1.29928 WP_005477226.1.31998 WP_005477226.1.35351 WP_005477226.1.35596 WP_005477226.1.35751 WP_005477226.1.36788 WP_005477226.1.37148 WP_005477226.1.37683 WP_005477226.1.39 WP_005477226.1.39142 WP_005477226.1.39379 WP_005477226.1.3961 WP_005477226.1.39756 WP_005477226.1.39842 WP_005477226.1.42776 WP_005477226.1.42858 WP_005477226.1.43185 WP_005477226.1.43895 WP_005477226.1.45633 WP_005477226.1.46057 WP_005477226.1.4734 WP_005477226.1.47510 WP_005477226.1.48035 WP_005477226.1.4861 WP_005477226.1.48612 WP_005477226.1.4902 WP_005477226.1.49432 WP_005477226.1.49920 WP_005477226.1.50640 WP_005477226.1.50833 WP_005477226.1.51945 WP_005477226.1.52959 WP_005477226.1.53064 WP_005477226.1.53943 WP_005477226.1.54059 WP_005477226.1.55108 WP_005477226.1.55354 WP_005477226.1.5595 WP_005477226.1.56068 WP_005477226.1.56836 WP_005477226.1.56842 WP_005477226.1.57129 WP_005477226.1.57332 WP_005477226.1.5768 WP_005477226.1.58791 WP_005477226.1.5962 WP_005477226.1.59887 WP_005477226.1.60089 WP_005477226.1.61129 WP_005477226.1.61745 WP_005477226.1.62401 WP_005477226.1.6274 WP_005477226.1.6404 WP_005477226.1.65279 WP_005477226.1.66850 WP_005477226.1.71278 WP_005477226.1.71997 WP_005477226.1.73712 WP_005477226.1.74603 WP_005477226.1.74813 WP_005477226.1.75461 WP_005477226.1.79694 WP_005477226.1.81752 WP_005477226.1.81782 WP_005477226.1.81805 WP_005477226.1.81887 WP_005477226.1.82387 WP_005477226.1.82791 WP_005477226.1.83010 WP_005477226.1.8373 WP_005477226.1.84036 WP_005477226.1.86416 WP_005477226.1.86700 WP_005477226.1.88312 WP_005477226.1.90588 WP_005477226.1.91910 WP_005477226.1.92596 WP_005477226.1.92816 WP_005477226.1.93458 WP_005477226.1.96237 WP_005477226.1.96264 WP_005477226.1.9642 WP_005477226.1.96491 WP_005477226.1.99805 gi|28900960|ref|NP_800615.1| 223926.VPA1105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]