SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224324.aq_1200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224324.aq_1200
Domain Number 1 Region: 9-222
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224324.aq_1200
Sequence length 241
Comment (Aquifex aeolicus)
Sequence
MTQPVRRRINVRMPAIGGQGAVSAAHIMATAADHAGYYAVSNPFYGAEKRMAPSESYVRI
GIEPIYDRGEVVYPDVIMVFHSQVITMGKSYTMPFYSGIKKNGLIIINAEEDLLSDEDKA
FLEERNVKIFNFSATKFAVEIAGTELATNMAMIGAFFGITQIVGMESIEEGIKARFLKKF
VASGGTASLDSAIERKFKKKLELIEKNIATARAAYEFANQWAKEQGIEPWLPKPEAVLQR
A
Download sequence
Identical sequences O67256
gi|15606440|ref|NP_213820.1| 224324.aq_1200 NP_213820.1.100253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]