SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224324.aq_1820 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224324.aq_1820
Domain Number 1 Region: 9-186
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.29e-30
Family Clp protease, ClpP subunit 0.017
Further Details:      
 
Domain Number 2 Region: 357-423
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000000641
Family NfeD domain-like 0.0033
Further Details:      
 
Weak hits

Sequence:  224324.aq_1820
Domain Number - Region: 215-320
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.011
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224324.aq_1820
Sequence length 425
Comment (Aquifex aeolicus)
Sequence
MKIILLSLFWVFFSFGKIFVAQWEGPITPTTADYVERTIQKAQKEGGTLYILLLNTPGGL
VESMRKIIQSFETAPFPIVVYVYPPGGRAASAGAIITIAADIAAMAPGTNIGAAHPVLAT
PQGREKKEKGKDVMMEKVLQDMLAFVRAIAKEKGRNVKVVEKMVKESLSLSAEEALKKGV
IDLIAYNLEDLLTKLEGKKVKKLNAVYEIRTKGKEVVFLKPSLREEFLKIITNPTVAYLL
LMLGFYGIFFELYNPGAIIPGVLGAICLLLGLYGLSVISINWLALLLIVLGILFFVLELL
TPTFGALALGGAISILLGSLFLVEEGSPYGEIPKQLIISVSIFSAIFFLGVGYLGLKAQK
RKKLTGIEGMIGEEGEAIVDFKNGRGKVFVHGEIWDAVSEDDIKKGDTVKVVGAKGLKLI
VKKSS
Download sequence
Identical sequences O67682
gi|15606868|ref|NP_214248.1| 224324.aq_1820 NP_214248.1.100253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]