SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224325.AF0471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224325.AF0471
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224325.AF0471
Sequence length 187
Comment (Archaeoglobus fulgidus)
Sequence
MPREVNIRIAGTGGQGVIKAGLVLAEAFALEGKNVVQTQSYGPEARGGASRADIIVSDDE
IDFPGLRRVDYLLVLHDSAYRKYYPQVDGETHVIYDSSLVNARRGLGFPFTETSIREFGT
PLFANMIAIGALTAMLGLQPEKVEVVIQKRMRKAEENVKAFRIGFEMGRRVTKPKVVSHV
VKPYILS
Download sequence
Identical sequences A0A075WCJ5 A0A101DDV3 O29779
gi|11498082|ref|NP_069307.1| 224325.AF0471 WP_010877978.1.27515 WP_010877978.1.34637 WP_010877978.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]