SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224325.AF1132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224325.AF1132
Domain Number 1 Region: 94-361
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-95
Family Enolase 0.0000024
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.35e-23
Family Enolase N-terminal domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224325.AF1132
Sequence length 366
Comment (Archaeoglobus fulgidus)
Sequence
MAPSGASTGSGEAVVVSPYRYEEIEEEVSKAIIGMSVFDQESVDEALRELDGTDNFSRIG
GNFAITASLAVAKAAAEILGLPLYAYVGGVFAKELPYPLGNVIGGGRHAEGSTSIQEFLV
IPVGAKTFFEAQRANAAVHKQLKKIFKERGIFAAKGDEGAWAAQISDEQAFEILSEAIQR
VEDELGVKVRMGIDVAATELWDGERYVYSDRKLTTEEQIAYMAELADRYDLLYIEDPLHE
KDFEGFAELTKQVKCMVCGDDIFVTNPEIIKKGIEVGAANTVLIKPNQNGTLSGTAKAVK
IAKDNGYSVVVSHRSGETEDETLAHLAVAFNAKLIKTGVVGGERISKLNELIRIEELMDK
PRMVMI
Download sequence
Identical sequences gi|11498732|ref|NP_069961.1| 224325.AF1132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]