SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224325.AF1781 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224325.AF1781
Domain Number 1 Region: 26-192
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.58e-26
Family Crotonase-like 0.066
Further Details:      
 
Domain Number 2 Region: 366-429
Classification Level Classification E-value
Superfamily NfeD domain-like 1.57e-17
Family NfeD domain-like 0.002
Further Details:      
 
Weak hits

Sequence:  224325.AF1781
Domain Number - Region: 223-357
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.017
Family Glycerol-3-phosphate transporter 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224325.AF1781
Sequence length 444
Comment (Archaeoglobus fulgidus)
Sequence
MPSLRDAMKLSPLFVLLLALLIAPVNAAELRVAKVEVRGEINQGTYLTLQHAYDFALRER
FDVLFVVLDTPGGLLSSTQKIVKMFLNSEVPVVVFVPRGAMCASAGSIILLSSHIAVMAD
GTAVGAATPVSVGFASAEVENKTVNYIAGYVKDIARERGRNEGVAEKFVTQALTLTAKEA
LEQGIIDYIANTEGEAIEGLKGRSAEIDGKLVTFEFDTYRVIEVKKPLQASIYEIISSPQ
LAAILLLLGIYLLIFGLTSPGLVPETVGAICLILALAGLGVIGINHLGLLLIVLGVIFLF
AELMTPTYGVLGAASVVSVVLGLLILFNEPLMPESFYDAFPKFVAGMGIGLGGIMTFMII
KIAQIRKKKSSVGEVVGEKGEVLEFSNGRGFARVRGEIWKVVSDEELEKGDEVEVIAREG
LTLRVRKIGGGGTEKGDAEVAGEN
Download sequence
Identical sequences O28493
WP_010879277.1.27515 WP_010879277.1.46508 224325.AF1781 gi|11499370|ref|NP_070609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]