SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.bll3935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.bll3935
Domain Number 1 Region: 17-315
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.72e-110
Family Glutaminase 0.00000204
Further Details:      
 
Domain Number 2 Region: 475-595
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-23
Family cAMP-binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 351-427
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000432
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.bll3935
Sequence length 613
Comment (Bradyrhizobium japonicum)
Sequence
MTPPPASAWTRSKPPLLRFLDTCLNEFSAETSGAVADYIPELGNADPAYFGISLATLDGH
VYEVGDSRVPFTIQSMSKPFVFALALDLLGAGRVESAIGVEPSGDPFNSIRLNSDNHPFN
PMVNAGAIACTGLIYDSKGAEAFEQIRLALSRFAGRDLAVDEAVYSSESQTGDRNRAIGY
LLKTNAVISDNVAAVLDVYFRQCAVLVTARDIAVMAATLANRGINPVTGEQVMSAYAISR
TLSVMTSSGMYDYAGEWIYRIGIPAKSGVGGGILAALPARLGLGSYSPKLDKHGNSVRGI
KVCEALSSHYDLHMLNRSDDARNAVIADYDIGKSPSRRVRRAQEREILAAHEQEVRIIEL
VGTLSLSAVDYVSRRLAGRPRPQFVIFDLHRVTSTTRAGARLVAEAFEELAALNVTVVLS
GVRRASKEWNTLREWTAELKNVRDFYLLDTAIEWAEDQIVYRYGGSIDFHETTELAEQPL
LEGLSADELAELGAICTIRTYQSGAKILTTGDPADALFFLRSGAVHVTLPDGVRLATLTA
GMAFGEMALLEQTRSADVFADMAATAFEAPLKDFERFREQHPRASERIMRNLAQLLADRL
IVANAKVDILTST
Download sequence
Identical sequences A0A2A6N361 Q89NA7
224911.bll3935 NP_770575.1.11505 WP_011086712.1.15658 WP_011086712.1.90507 gi|27379046|ref|NP_770575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]