SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.bll4952 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.bll4952
Domain Number 1 Region: 34-220
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.46e-25
Family Clp protease, ClpP subunit 0.053
Further Details:      
 
Domain Number 2 Region: 393-459
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000366
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.bll4952
Sequence length 468
Comment (Bradyrhizobium japonicum)
Sequence
MQTMKAALVTAIGVVALICCLLPSSAEENGRLALIVSIDGAIGPASASYVKEALAHASER
RAEVVLLRINTPGGLNSSMREIVADVLASPVPVVGYVAPSGAHAASAGTYILYATHIAAM
ASGTNIGAATPVQIGGPLPGLPSGTPDKGGKDKKDGDQQSEKDQPKDAMTAKVTNDAVAF
IRSLAELRNRNVDWAEKAVREAATLSANGALEAHAIDLVARDQAELLRQLDGRVVEVAGG
KTQRLATKDAVVEAIDPGWISRFLAVITDPNVAFILLMVGIYGLIFEFMSPGAVAPGVVG
AICLLIGLYALNLLPINYAGLALMLVGIVLLTVEAFNPTVVIGLGGIVAFVLGALMLFRV
EAPGYHLSWWVIGIAATVFTGFALVVLGSLRRAANAPERVGAQAMRGLPAEVLDWRGSEG
HVFAHGERWQARGAETFKPGETVEVANVVDLTLLIRRAPARTGEGDPS
Download sequence
Identical sequences A0A2A6MXG8 Q89KF5
NP_771592.1.11505 WP_011087715.1.15658 WP_011087715.1.90507 gi|27380063|ref|NP_771592.1| 224911.bll4952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]