SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.bll5338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.bll5338
Domain Number 1 Region: 720-952
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0081
Further Details:      
 
Domain Number 2 Region: 49-228
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.88e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.034
Further Details:      
 
Domain Number 3 Region: 438-622
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000383
Family PFOR PP module 0.061
Further Details:      
 
Weak hits

Sequence:  224911.bll5338
Domain Number - Region: 271-397
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000879
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.bll5338
Sequence length 1163
Comment (Bradyrhizobium japonicum)
Sequence
MGINQGPISLDQKYTQDTGHVFTTGIQALVRLPMAQIRRDRANGLNTAGFISGYRGSPLG
GYDQQLFAARKHLEQYNIKFQPGVNEDLAATAVWGSQQLNLSPGAKYDGVVGIWYGKGPG
VDRCGDVFRHGNAAGSAKNGGVLCLAGDDHGAKSSTVPHQSDHAFMSALMPYLYPSSIHE
MIEMGLLGIAMSRYSGCWVGMKVITETVETTAEIDLTDEMKPFIIPPDFELPPGGLNLRW
PDDRFEQDRRLQDYKGFAAIAFARANRVNRVTMDSPNARFGIMASGKSYEDVRQALRELG
VTEEVAAKIGLRLYKIGMPWPLEPEGVRQFAVGLEEIFIIEERREIVENQVKQELFNWRD
DVRPRIVGKMDEHDKRFLTFAAELSVASLATSITERLLRLNLNPEIAEMLRVKADWFNGR
QATQMQATAPVSRTPYFCSGCPHNTSTKVPEGSRALAGIGCHFMALWMDRSTETFTHMGG
EGVPWVGIAPFTNENHIFANLGDGTYFHSGLLAIRQAVASKTNITYKILYNDAVAMTGGQ
RHDGDLSPQQITFQLHAEGIREIYLVSEAPDTYPADTIAPGVKKYHRDELDNVMKMCREY
KGTSAIVFVQTCAAEKRRRRKRGLMEDPARRVMINPAVCEGCGDCSVQSNCISVEPLETE
FGRKRAINQSSCNKDYSCVKGFCPSFVTVDGGAPRHRAPAELEEIGALPEPASRPTLDKP
YNIAVGGVGGTGVLTIGALLGMAAHIEGKASMILDMSGLAQKGGAVLSHVRLSDHPAEVT
CSRIVTGTADLVLAADEVVAVAKDTISLCDSSRTRGIINSHVIPTADFVLNRDFNFQTRK
LNGLLETALHKDSVFFDFTKPAEQLLGDSIATNMMMMGYAYQKGLFPLAAESIEQAIEVN
GVAIKMNKEAFRLGRLAVADPERLAGMLKGTGEVVAPKTLDAMTLDEIVEHRAKHLTAYQ
NGRLAKRYRKLVDQVRDAARQGGYDDALPRAVAVNYAKLLAYKDEYEVARLFTDGAFEQQ
LRDQFEGDFKFSFNLAPPILASGVDALGRPKKRAFGPWMLKVFRVLAKFKFLRGTPLDIF
GRSADRKLERDLIVGYEKDVATVLGLLSPLTIDTAVELLSLPDRIRGYGPVKEKAVADAK
ARYAQLAADLASPPPAPRQIAAE
Download sequence
Identical sequences A0A2A6MVB0 Q89JE5
224911.bll5338 NP_771978.1.11505 WP_011088094.1.15658 WP_011088094.1.90507 gi|27380449|ref|NP_771978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]