SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.bll5894 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.bll5894
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000151
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224911.bll5894
Sequence length 367
Comment (Bradyrhizobium japonicum)
Sequence
MKGNALALCATGTWTASFAPVLERMVADAEKLAGSPQSIFIDVSEVAKLDTFGAWLIERL
RRSLTQGTVEAQIAGLSANYSSLVDEVRRVRATPVVDAGTITITGMLDQIGRAVAGVAGT
VAGLIDMLGAVLAAGGRVLIHPRSFRLTSTVHHMEQVCWRAVPIIVLITFLIGCIIAQQG
IFHFRRFGADIFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRT
MGFDPIEVLVLPRMLALVLALPILAFLGAMAALYGGGLVAWLYGGVDPEAFLLRLRDAIS
IDHFIVGIVKAPVMAAVIGIVACVEGLAVQGSAESLGQHTTASVVKGIFFVIVMDGVFAI
FFASIGM
Download sequence
Identical sequences Q89HU5
224911.bll5894 gi|27381005|ref|NP_772534.1| NP_772534.1.11505 WP_011088635.1.15658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]