SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.bll7749 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  224911.bll7749
Domain Number - Region: 14-88
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.00785
Family Type 2 phosphatidic acid phosphatase, PAP2 0.07
Further Details:      
 
Domain Number - Region: 92-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0301
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.bll7749
Sequence length 147
Comment (Bradyrhizobium japonicum)
Sequence
MTDTFVSLGTWNWLIFAFILMALETIAPGVFLFWLGLAALLVGLISFAVHLSWQTQLVMF
AIFAAAAVPVWRRLARPRPDASASPFLNKRTEALLGREFTLEKPIVDGNGTMRIGDTVWR
VAGPDTPAGTRVKVVQVDGVNLTVAVA
Download sequence
Identical sequences A0A0E4FRM4 A0A0M9B7K4 Q89CP7
GO.2658 NP_774389.1.11505 WP_011090474.1.15658 WP_011090474.1.2739 WP_011090474.1.53516 WP_011090474.1.53518 WP_011090474.1.67972 WP_011090474.1.69380 WP_011090474.1.90507 224911.bll7749 gi|27382860|ref|NP_774389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]