SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.blr2341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr2341
Domain Number 1 Region: 23-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000706
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.blr2341
Sequence length 118
Comment (Bradyrhizobium japonicum)
Sequence
MYRNFARAGAAMALNPTEPKWSLRLPADCSIAAIRSVYDLIREAFGREQRLEIDCSRVDK
ADVTSIQLLLSTAKTGEAQGRPVVLTAFSQSLRNTLRRAGFASEAMIEQHFPQKKDGT
Download sequence
Identical sequences A0A2A6MTS5 Q89SQ9
224911.blr2341 NP_768981.1.11505 WP_011085129.1.15658 WP_011085129.1.90507 gi|27377452|ref|NP_768981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]