SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.blr2848 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr2848
Domain Number 1 Region: 443-555
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.08e-16
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224911.blr2848
Sequence length 573
Comment (Bradyrhizobium japonicum)
Sequence
MKHWIDWLPAIETLRRYEAAWLPRDIFAGLVLATMLVPVGIAYATASGLPGIAGLYATIV
PLLVYALFGPSRILVLGPDSALAAVILGVVVPLSGGDPLRAATLAAMMAIVSGTVCILAG
IARLGFVTELLSKPIRYGYMNGIALTVLISQLPKLFGFSIESEGPLRSLWAIADAILEGK
TNWIAFGIGLGTLTVILLLRNSKRLPGILIAVVGATAIVGVLDLGTRYGVAVLGPLPQGL
PGFAIPWITYGDIVPVLVGGCAIALVSFADTSVLSRAYAARLGTHVDPNQEMVGLGAANL
ATGFFQGFPISSSASRTPVAEAAGARTQLTSVVGALAIAILLLVAPNLLQHLPTAALAAV
VIAAAIGLFEVTDLKRIYRIQQWEFWLSMVCFVGVAVLGVIPGIGLAIAIAIAEFLWDGW
RPHSAVLGRAHGVKGYHDITRYPDARQIPGLVLFRWDAPLFFANAEFFKERVLDAVAKSP
TPVRWLVVAAEPVTSVDVSAGDTIAELDEALHAQGIEFCFAELKDPVKDKLKRFGLFSQL
GEQYFFPTIGAAVSSYLEINGVEWEDWEDQAKR
Download sequence
Identical sequences A0A2A6N8U1 Q89RC4
gi|27377959|ref|NP_769488.1| 224911.blr2848 NP_769488.1.11505 WP_011085632.1.15658 WP_011085632.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]