SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.blr3465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr3465
Domain Number 1 Region: 40-131
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000497
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.blr3465
Sequence length 147
Comment (Bradyrhizobium japonicum)
Sequence
MALQFIVGAIVSVINIMIHALVTVGAIGIARTAGLRHDAWPRLHLMAVMVATASALMVAH
TMEVLVWALAYALVGAAPAGSDLIYFAFVNYTTLGYGDITPIQAWRLTGPMTAMNGILMF
GWSTAVLFEVLRKTLDDLGVTRLPDGR
Download sequence
Identical sequences A0A0E4FYM0 A0A0M9BE75 Q89PL5
224911.blr3465 NP_770105.1.11505 WP_011086249.1.15658 WP_011086249.1.2739 WP_011086249.1.53516 WP_011086249.1.53518 WP_011086249.1.67972 WP_011086249.1.69380 WP_011086249.1.90507 gi|27378576|ref|NP_770105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]