SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.blr5872 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr5872
Domain Number 1 Region: 146-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.28e-81
Family D-glucarate dehydratase-like 0.00000000216
Further Details:      
 
Domain Number 2 Region: 15-144
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.53e-33
Family Enolase N-terminal domain-like 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224911.blr5872
Sequence length 452
Comment (Bradyrhizobium japonicum)
Sequence
MAQTDISGAPVAGAPVVTAMQVIPVAGRDSMLLNLSGAHAPFFTRNIVILTDNAGHTGVG
EVPGGQKIWQTLQDARDLVIGKTVGAMNNILADVRTAFADRDAGGRGKQTFDLRVMIHAV
TAIESALLDLLGQHLNLPVAALLGEGQQRKSVETLGYLFFVGDISKSRLDYVTGETGKAE
WFNLRHQEAMTPETVVRLAEATHDHYGFADFKLKGGVLRGEQEIEAVTAIAKRFPNARVT
LDPNGAWSLDEAVSLCKDMHGILAYAEDPCGAEAGFSGREIMAEFRRATGLPTATNMIAT
DWRQLSHALRLGAVDIPLADPHFWTMQGSVRVAQTCRDNGLTWGSHSNNHFDISLAMFTH
VGAAAPGKVTAIDTHWIWQDGQALTREPLRIKGGKIAVPDRPGLGIEIDRAAIDAAHDLY
KQHGLGARDDAIAMQDLIPGWTFDDKRPCLVR
Download sequence
Identical sequences A0A2A6MTS7 Q89HW7
224911.blr5872 NP_772512.1.11505 WP_011088613.1.15658 WP_011088613.1.90507 gi|27380983|ref|NP_772512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]