SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224911.blr7589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr7589
Domain Number 1 Region: 718-954
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.025
Further Details:      
 
Domain Number 2 Region: 21-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000112
Family Pyruvate oxidase and decarboxylase Pyr module 0.045
Further Details:      
 
Domain Number 3 Region: 433-617
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000226
Family Pyruvate oxidase and decarboxylase PP module 0.011
Further Details:      
 
Domain Number 4 Region: 267-370
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000419
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224911.blr7589
Sequence length 1152
Comment (Bradyrhizobium japonicum)
Sequence
MDAIPSLDAYELSDRYDREDGRVFLTGTQAIVRIALDQAKRDRMRGLNTAGFISGYRGSP
LGGIDLELWRIQERLKRDRIEFLPAVNEDLAATAVLGSQQVETQAEREVDGVFGLWYGKG
PGVDRSGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDVAFMSWFMPTLHPADV
GEYLAFGEYGYALSRFSGMWVGFKAISEIVESGASVALRPPRAFRTPDFTPPPGGLHYRW
PDLPGPQIEERLEAKKHAVYAFAKANPIDRHIYDIPNATYGIVTTGKAHLDLMEALRLMG
LDEAACRSIGIDVYKVGMVWPLALHDAMDFVKGKREILVVEEKRGIIESQFKEYFYDYPG
TKPERMVGKHDERGARLISWIGELSPRALAGVLARRLDPMFPGLNLAARAAALMPEAART
INVSGATRTPYFCSGCPHNTSTKVPEGSKALAGIGCHFMASWMDRETSSLIQMGGEGVNW
AASSRFTGNRHIFQNLGEGTYYHSGSMAIRQAIAAKANITYKILFNDAVAMTGGQPVDGP
ISVHAIAHSVRAEGVARIALVSDDPAQFSPADLPIGVTIHPREEMDPVQRELREVSGVSV
LIYQQTCATEKRRRRKRGQMADPKRFAYINDLVCEGCGDCSVESNCLSVEPKETPFGRKR
QINLSTCNKDFSCLNGFCPSFVTVEGATRRKKSASQIDAVGRAATLPLPAPVALDRPYDL
LVTGVGGTGVITVGALIGMAAHLERSGVSVLDFTGFAQKFGPVLSYIRLAASPEALHQVR
IDQGAADALIGCDLVVSSAPKASGTYRRGTRAAVNTAEMPTGDVVRFRDADLASPARLRA
IRQVVGNDNLDTINANALAERLLGDAVYANIIMLGFAWQRGLIPVSLQALLRAIELNGIA
VERNKQAFAWGRIAAADPDSLPRADDTPKTETLDQLIARRADFLTAYQNAAYAARYRTIV
NKVRNAEAALSSEAMTEAVARVLFKLMAYKDEYEVARLHMQTGFLDELKREFEDGFSVQY
HLAPPFLPSERDARGRPRKRAFGQWIQTPLALLARLKGLRGTPLDPFGYTAERRTERELI
SWYEGVIERMLHELDAARLPDFIAIAKAPMEIRGYGPVKDIAVAKVKPEVERRLADVITE
LAPVVWTAPRWI
Download sequence
Identical sequences Q89D54
224911.blr7589 NP_774229.1.11505 WP_011090318.1.15658 gi|27382700|ref|NP_774229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]