SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224914.BMEI1294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224914.BMEI1294
Domain Number 1 Region: 26-158
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-25
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 168-241
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000114
Family GntR-like transcriptional regulators 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224914.BMEI1294
Sequence length 251
Comment (Brucella melitensis)
Sequence
MVVVPFALDQNQKLAARTPCNVCEDCCVRSMAVCSALDDGDLAALEAIMTSKKLDTNEML
VEEGEPKLRVYSLTSGMLRIYTSLPDGRRQIAGFLFPGDFLGLADDEVYSLSAEAVVPSA
LCAFSAKEIERLMERFPKLKERLYQMTRLALRTARDNQLVLGRLAPVEKLASFLLVLSAR
AEKRGEKPNPVHLLMNRTDIADYLGLTIETVSRSFTKLKTQGLIQLRDANTVEILSRRSL
AVVAGLDPDNL
Download sequence
Identical sequences Q8YG67
gi|17987577|ref|NP_540211.1| WP_004683392.1.12925 WP_004683392.1.1327 WP_004683392.1.14323 WP_004683392.1.19182 WP_004683392.1.23391 WP_004683392.1.33466 WP_004683392.1.47516 WP_004683392.1.48396 WP_004683392.1.49089 WP_004683392.1.50924 WP_004683392.1.5609 WP_004683392.1.56687 WP_004683392.1.62990 WP_004683392.1.62997 WP_004683392.1.6942 WP_004683392.1.69522 WP_004683392.1.70760 WP_004683392.1.75678 WP_004683392.1.79993 WP_004683392.1.96710 224914.BMEI1294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]