SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224914.BMEI1707 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224914.BMEI1707
Domain Number 1 Region: 183-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.32e-68
Family D-glucarate dehydratase-like 0.000000124
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.2e-37
Family Enolase N-terminal domain-like 0.00000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224914.BMEI1707
Sequence length 425
Comment (Brucella melitensis)
Sequence
MTKITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDDEALKGHGLTFTIGRGND
ICCHAILAMRHLVVGASLDEIRAAPGKFWHHLTGDSQLRWIGPEKGAMHLATGAVVNAIW
DLLAKQAGKPVWRLVSELSPEEIADIVDYRYLTDVLTRDEAIEILRKAESGKAERIATLE
AEGYACYTTSAGWLGYDDAKLRRLCQEAIDEGFNHVKMKVGHDLEDDIRRLTIAREVIGP
DRYLMIDANQVWEVDQAIEWVRRLAFANPFFIEEPTSPDDVAGHRKIRAAIGPVKVATGE
MCQNRIMFKQFIAEGAIDVVQIDSCRMGGLNEVLAVLLMAAKYDLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKEGRVIEYVDHLHEHFLDPCIIRNAAYMPPSLPGFSIEMKPQSIAQ
YAFKG
Download sequence
Identical sequences A0A0E1X2R2 A0A0H3G1P8 A0A1Z1ZJM0 A0A2D2BMB0 A9M7T1 B0CJ98 C0RGU3 C7LFU8 C9V8C0 D0RLN4 Q8YF20
gi|560147740|ref|YP_008840556.1| gi|376279940|ref|YP_005153946.1| gi|161618225|ref|YP_001592112.1| gi|23501152|ref|NP_697279.1| gi|376274985|ref|YP_005115424.1| gi|23501152|ref|NP_697279.1| gi|225851772|ref|YP_002732005.1| gi|340789864|ref|YP_004755328.1| gi|163842508|ref|YP_001626912.1| gi|17987990|ref|NP_540624.1| 204722.BR0245 224914.BMEI1707 470137.BSUIS_A0245 483179.BCAN_A0247 546272.BMEA_A0253 568815.BMI_I248 gi|384210618|ref|YP_005599700.1| gi|256368706|ref|YP_003106212.1| WP_004684720.1.100018 WP_004684720.1.100204 WP_004684720.1.100628 WP_004684720.1.100807 WP_004684720.1.101247 WP_004684720.1.101411 WP_004684720.1.102026 WP_004684720.1.10307 WP_004684720.1.10844 WP_004684720.1.11066 WP_004684720.1.1158 WP_004684720.1.11769 WP_004684720.1.11933 WP_004684720.1.12704 WP_004684720.1.13020 WP_004684720.1.1327 WP_004684720.1.13576 WP_004684720.1.13592 WP_004684720.1.14323 WP_004684720.1.15325 WP_004684720.1.16733 WP_004684720.1.17733 WP_004684720.1.1800 WP_004684720.1.18494 WP_004684720.1.19182 WP_004684720.1.19483 WP_004684720.1.19645 WP_004684720.1.2214 WP_004684720.1.22142 WP_004684720.1.22340 WP_004684720.1.23391 WP_004684720.1.23458 WP_004684720.1.24496 WP_004684720.1.2483 WP_004684720.1.24895 WP_004684720.1.24923 WP_004684720.1.25135 WP_004684720.1.25450 WP_004684720.1.25561 WP_004684720.1.27052 WP_004684720.1.29765 WP_004684720.1.29997 WP_004684720.1.31094 WP_004684720.1.31463 WP_004684720.1.31635 WP_004684720.1.31644 WP_004684720.1.31680 WP_004684720.1.32779 WP_004684720.1.33289 WP_004684720.1.33466 WP_004684720.1.3390 WP_004684720.1.34183 WP_004684720.1.34225 WP_004684720.1.34423 WP_004684720.1.35577 WP_004684720.1.36149 WP_004684720.1.36712 WP_004684720.1.3681 WP_004684720.1.38343 WP_004684720.1.38790 WP_004684720.1.38925 WP_004684720.1.40138 WP_004684720.1.40189 WP_004684720.1.408 WP_004684720.1.4091 WP_004684720.1.41105 WP_004684720.1.41344 WP_004684720.1.41893 WP_004684720.1.41941 WP_004684720.1.41950 WP_004684720.1.42065 WP_004684720.1.4207 WP_004684720.1.42071 WP_004684720.1.4295 WP_004684720.1.43006 WP_004684720.1.43058 WP_004684720.1.43148 WP_004684720.1.4319 WP_004684720.1.43359 WP_004684720.1.43583 WP_004684720.1.43689 WP_004684720.1.43928 WP_004684720.1.44045 WP_004684720.1.44060 WP_004684720.1.44294 WP_004684720.1.44793 WP_004684720.1.44949 WP_004684720.1.44989 WP_004684720.1.45546 WP_004684720.1.47516 WP_004684720.1.47545 WP_004684720.1.48075 WP_004684720.1.48184 WP_004684720.1.48396 WP_004684720.1.48727 WP_004684720.1.49089 WP_004684720.1.49427 WP_004684720.1.49542 WP_004684720.1.49753 WP_004684720.1.50924 WP_004684720.1.50952 WP_004684720.1.51553 WP_004684720.1.52027 WP_004684720.1.52478 WP_004684720.1.52541 WP_004684720.1.5307 WP_004684720.1.54481 WP_004684720.1.55047 WP_004684720.1.55284 WP_004684720.1.55585 WP_004684720.1.5609 WP_004684720.1.56313 WP_004684720.1.56621 WP_004684720.1.56687 WP_004684720.1.57541 WP_004684720.1.57564 WP_004684720.1.58260 WP_004684720.1.58868 WP_004684720.1.59091 WP_004684720.1.5971 WP_004684720.1.59985 WP_004684720.1.60631 WP_004684720.1.60920 WP_004684720.1.61081 WP_004684720.1.61543 WP_004684720.1.62592 WP_004684720.1.62872 WP_004684720.1.62990 WP_004684720.1.62997 WP_004684720.1.63628 WP_004684720.1.63732 WP_004684720.1.6440 WP_004684720.1.64585 WP_004684720.1.64849 WP_004684720.1.64883 WP_004684720.1.65199 WP_004684720.1.65299 WP_004684720.1.65501 WP_004684720.1.65651 WP_004684720.1.66078 WP_004684720.1.66268 WP_004684720.1.66340 WP_004684720.1.66407 WP_004684720.1.67107 WP_004684720.1.67402 WP_004684720.1.67659 WP_004684720.1.68488 WP_004684720.1.69522 WP_004684720.1.69997 WP_004684720.1.70296 WP_004684720.1.70570 WP_004684720.1.70760 WP_004684720.1.71002 WP_004684720.1.72439 WP_004684720.1.72533 WP_004684720.1.73628 WP_004684720.1.73739 WP_004684720.1.7388 WP_004684720.1.74005 WP_004684720.1.74236 WP_004684720.1.75128 WP_004684720.1.75563 WP_004684720.1.75678 WP_004684720.1.76877 WP_004684720.1.77165 WP_004684720.1.77281 WP_004684720.1.77683 WP_004684720.1.77685 WP_004684720.1.78590 WP_004684720.1.78716 WP_004684720.1.79327 WP_004684720.1.79993 WP_004684720.1.80059 WP_004684720.1.8012 WP_004684720.1.80167 WP_004684720.1.80365 WP_004684720.1.81027 WP_004684720.1.81276 WP_004684720.1.81377 WP_004684720.1.81558 WP_004684720.1.81674 WP_004684720.1.82205 WP_004684720.1.82390 WP_004684720.1.82595 WP_004684720.1.82753 WP_004684720.1.82834 WP_004684720.1.82990 WP_004684720.1.83161 WP_004684720.1.84207 WP_004684720.1.84512 WP_004684720.1.84764 WP_004684720.1.85684 WP_004684720.1.85721 WP_004684720.1.86923 WP_004684720.1.87893 WP_004684720.1.88404 WP_004684720.1.88424 WP_004684720.1.88867 WP_004684720.1.89113 WP_004684720.1.90027 WP_004684720.1.90420 WP_004684720.1.9096 WP_004684720.1.91081 WP_004684720.1.91768 WP_004684720.1.91958 WP_004684720.1.92383 WP_004684720.1.9303 WP_004684720.1.93230 WP_004684720.1.93367 WP_004684720.1.94770 WP_004684720.1.95141 WP_004684720.1.95148 WP_004684720.1.95178 WP_004684720.1.96661 WP_004684720.1.96710 WP_004684720.1.97240 WP_004684720.1.97320 WP_004684720.1.97860 WP_004684720.1.98362 WP_004684720.1.98704 gi|384444329|ref|YP_005603048.1| gi|384407718|ref|YP_005596339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]