SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224914.BMEI1712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224914.BMEI1712
Domain Number 1 Region: 115-358
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.75e-74
Family D-glucarate dehydratase-like 0.0000653
Further Details:      
 
Domain Number 2 Region: 3-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.37e-31
Family Enolase N-terminal domain-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224914.BMEI1712
Sequence length 372
Comment (Brucella melitensis)
Sequence
MARIERFELRMVDLPPRAKRTDAIQSFVSQETPIVTITDSDGAVGTGYSYTIGTGGSSVM
RLLADHLAPLVIGEDADCIEAIWRRLEFATHATTIGAITALALAAIDTALWDLRAKKQNL
PLWKLAGGARDHCPLYTTEGGWLHIEKEALVEDALQAKAKGFTGSKIKIGKPHGAQDYAR
LSAVRAAVGAAFEIMTDCNQGFTVDEAIRRAERLKELDLAWIEEPLPADDLDGHMRLARS
TAAPVAVGESIYSIRHFREYMHKGACSIVQVDVARIGGITPWLKVAHMAEAFDIPVCPHF
LMELHVSLVCAVPNGRYVEYIPQLDDLTDKGMEIRDGHAVAPSQPGIGIAWDWDAVRSRS
IGEFTREIVRAP
Download sequence
Identical sequences Q8YF15
224914.BMEI1712 gi|17987995|ref|NP_540629.1| WP_004684716.1.23391 WP_004684716.1.47516 WP_004684716.1.48396 WP_004684716.1.49089 WP_004684716.1.56687 WP_004684716.1.62990 WP_004684716.1.62997 WP_004684716.1.6942 WP_004684716.1.69522 WP_004684716.1.75678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]