SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 225849.swp_1887 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_1887
Domain Number 1 Region: 12-216
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.53e-25
Family Clp protease, ClpP subunit 0.069
Further Details:      
 
Domain Number 2 Region: 393-453
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000301
Family NfeD domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_1887
Sequence length 464
Comment (Shewanella piezotolerans WP3)
Sequence
MHGWKLALLVILTALLCMGVQSADENTLGTEIPVVSVKGAIGPAVGKQLTAEINAANQQH
NVPLIIITLDTPGGLVSSLRSINQTILTSDIPVACLVYPKGARAASAGTYMLYACHVAAM
ATATTLGAATPVQMGPSAPSPDKINPADKEGDNTPENPSPSAMEKKILNDAIAYIRSLAQ
LRGRNQEWAELAVTEAATLTATEALALNVIDLLAESPQQLVRNLDGKVIEFGDVEMTLNL
KGAALVNKQPSWQHQFIATITNPNIAYILMIIGVYGLLLEFYSPGIGVAGITGAISLIIA
LYAFQMLPLSYAGLALLMLGIVLLITESMVPSFGIFGVGGIAAFVVGSIFLFDTPQPQFQ
VSPILIASIAFISLLFFVFALGFILRMRKNAVVTGQEAIIGADAIVIDNFKGHGFVLLNG
ERWHAISSQALRKGQSVTVNDINGLSLTVSTVDPKETSNGTTHH
Download sequence
Identical sequences B8CLJ6
gi|212634709|ref|YP_002311234.1| 225849.swp_1887 WP_020912023.1.101980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]