SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 225849.swp_3057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_3057
Domain Number 1 Region: 373-456
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000011
Family Anti-sigma factor antagonist SpoIIaa 0.035
Further Details:      
 
Weak hits

Sequence:  225849.swp_3057
Domain Number - Region: 84-176,268-360
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0183
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_3057
Sequence length 478
Comment (Shewanella piezotolerans WP3)
Sequence
MVGLYAAFIMGLITALIGGRPGMISGATGAMAVVMVALVAEHGVQYLFAAVVLAGLIQVS
AGVLKLGKFIRIVPYPVMIGFVNGLAIVIFLAQLGQFQTPDANGVMSWLPQDQLLLMLGL
VALTMAIIQFLPKLTTTIPSSLAAILTVTLLVTFLNLDTRTVLDFLKSMSGDEHATIAGS
LPTFSIPAVEFSLATLYIILPYSLILAAVGLIESLLTLTVIDEMTGTRGRGNKECIGQGV
GNITSGFFGAMGGCAMIGQSMININSGGRGRLSGITAAVALLAFILFGSSLIEMIPLAAL
VGVMFMVVLGTFEWASFKVMRKVPKHDAFVIILVTIVTVFTDLAFAVFVGVIVSALVFAW
EHAKHINVEISEDKNGWKVYKLNGPLFFGSVAEFLELFHAKTDPEDVIVDFQNSRVCDHS
ALDAIDTLAERYVSAGKKLHLRHLSNDCKELLHKAGDLVEVNLIEDPHYKVADDKLDS
Download sequence
Identical sequences B8CPR1
225849.swp_3057 gi|212635836|ref|YP_002312361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]