SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 225849.swp_4400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_4400
Domain Number 1 Region: 399-484
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000108
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_4400
Sequence length 495
Comment (Shewanella piezotolerans WP3)
Sequence
MFKNFKIDWISNIRGDMLAGIVVALALIPEAIAFSIIAGVDPKVGLYASFSISVVIAFTG
ARPGMISAATGAMALLMVTLVKEHGLQYLLAATVLTGLLQILAGYLKLGDLMRFVSRSVV
TGFVNALAILIFMAQLPELSNVTWHVYAMTLAGLAIIYLFPYLPIIGKVVPSPLVCIVGL
TAFTMMFDVDIRTVGDMGDLPDTLPIFLWPDVPLNLDTLLIVLPYSLGLAVVGLLESMMT
ATIVDDLTDTCSDKNRECKGQGLANISTGLLGGMAGCAMIGQSMINIKSGGRGRLSSFSA
GIFLLIMVVFLGPWLKQIPMAALVAIMIMVAIGTFSWRSIIDMKKHPLSTNIVMLSTVVV
VVATHNLAIGVLVGVLLASLFFANKISRMMVIKRNNAKNDSCEYRVIGQVFFASADKFID
SFDFKQVLESVTIDLSATHFWDVTAVSALDKVVIKFRREGTQVNLIGMNQATRTIVDKFG
VHDKPEEVERLLAGH
Download sequence
Identical sequences B8CTD6
gi|212637107|ref|YP_002313632.1| 225849.swp_4400 WP_020914380.1.101980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]