SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 226186.BT_1313 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_1313
Domain Number 1 Region: 170-379
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-49
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 46-162
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.21e-22
Family Enolase N-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_1313
Sequence length 383
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MPNRRDFLKTAAFATLGSGIAVSQVLAGECMPSAIHINKYGIGGKMKMTFFPYELKLRHV
FTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQL
EDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTP
DVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIH
WLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLM
KCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRF
KGVEVVNGKITLNDLPGIGVMKI
Download sequence
Identical sequences Q8A861
226186.BT_1313 gi|29346723|ref|NP_810226.1| NP_810226.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]