SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 226186.BT_3181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_3181
Domain Number 1 Region: 446-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-19
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_3181
Sequence length 559
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKLFEFKPKLVSCLKNYSKETFMADLMAGVIVGIVALPLAIAFGIASGVSPEKGIITAII
AGFIISLLGGSKVQIGGPTGAFIVIIYGIIQQYGEAGLIVATLMAGVLLILLGVFKLGAV
IKFIPYPIIVGFTSGIAVTIFTTQIADIFGLSFGGEKVPGDFVGKWMIYFRHFDTVNWWN
TIVSIVSIIIIAITPRFSKKIPGSLIAIIVVTVAVYLMKTYGGIDCIPTIGDRFTIKSEL
PDAVVPALDWEAIKNLFPVAITIAVLGAIESLLSATVADGVIGDRHDSNTELIAQGAANI
VAPLFGGIPATGAIARTMTNINNGGKTPIAGIIHAIVLLLILLFLMPLAQYIPMACLAGV
LVIVSYNMSGWRVFKALLKNPKSDVTVLLITFFLTVIFDLTVAIEVGLIIACVLFMKRVM
ETTEISVITDEIDPNKESDIAVNEENIMIPKGVEVYEITGPYFFGIATKFEETMAQLGDR
PNVRIIRMRKVPFIDSTGIHNLTTLCEMSQKEKITVILSGVNEKVYKVLEKSGFYELLGK
ENICPNFKIALDRAEEVMK
Download sequence
Identical sequences Q8A2X4
226186.BT_3181 NP_812093.1.73244 GO.9036 gi|29348590|ref|NP_812093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]