SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 226186.BT_4703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_4703
Domain Number 1 Region: 121-338
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.31e-54
Family D-glucarate dehydratase-like 0.00068
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.62e-22
Family Enolase N-terminal domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_4703
Sequence length 341
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MDCKIDIIPRVLHFKQPAGTSRGTYTTRKVWYLHFTAPEFPNWVGIGECAPLPNLSCDDL
PDYEEVLAKICRQVENQGGKLDMEALCKYPSILFGLETAIRHFFEGSWALWDTPFSRGEA
GIPINGLIWMGDFNRMLAQIEKKMEAGFRCIKLKIGAINFEEELALLQHIRSHYSSKEIE
LRVDANGAFSPTDAMEKLKRLSELDLHSIEQPIRAGQWEEMARLTSESPLPIALDEELIG
YNTWEEKQRLLSAIRPQYIIIKPSLHGGLAGGEEWIAEAEKLNIGWWITSALESNIGLNA
IAQWCATFQNPLPQGLGTGLLFTDNVEMPLEIRKDCLWFCK
Download sequence
Identical sequences A0A0P0EU62 C6IQC4 Q89YM8
APC82248 NYSGXRC-9401a gi|29350111|ref|NP_813614.1| NP_813614.1.73244 WP_008766782.1.24025 WP_008766782.1.28290 WP_008766782.1.29471 WP_008766782.1.59346 WP_008766782.1.97929 226186.BT_4703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]