SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 226900.BC2056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226900.BC2056
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000000157
Family NfeD domain-like 0.0028
Further Details:      
 
Weak hits

Sequence:  226900.BC2056
Domain Number - Region: 10-58
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0262
Family Clc chloride channel 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 226900.BC2056
Sequence length 142
Comment (Bacillus cereus ATCC14579)
Sequence
MAAWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFAPDALLLQVTVGAIVSLT
LTFFTKRISKNFREAKGFTDTVDMLVGKRGIVMQAITNEANGIVKVDGDTWTAIADSSID
AGEKVVVIKRHSTILQVKKESE
Download sequence
Identical sequences A0A0D1P9S3 A0A0G4D3R2 A0A0J6R329 A0A0U0JKB5 A0A1Q9KJG2 A0A229M6E8 A0A243D3J4 A0A243HR64 A0A243J1S8 A0A243K3C9 A0A243L7E9 B7HJI4 C2T091 C2UCY5 C3E2M0 J8I027 J8NIZ9 Q81EC6
GO.2693 226900.BC2056 405532.BCB4264_A2063 NP_831824.1.86172 WP_000741976.1.10584 WP_000741976.1.10745 WP_000741976.1.1354 WP_000741976.1.14006 WP_000741976.1.18914 WP_000741976.1.20208 WP_000741976.1.20651 WP_000741976.1.22699 WP_000741976.1.23540 WP_000741976.1.24680 WP_000741976.1.25290 WP_000741976.1.26513 WP_000741976.1.26637 WP_000741976.1.26826 WP_000741976.1.28237 WP_000741976.1.33201 WP_000741976.1.33717 WP_000741976.1.36221 WP_000741976.1.38345 WP_000741976.1.42485 WP_000741976.1.44956 WP_000741976.1.45317 WP_000741976.1.46326 WP_000741976.1.47975 WP_000741976.1.4964 WP_000741976.1.5025 WP_000741976.1.54240 WP_000741976.1.54736 WP_000741976.1.55116 WP_000741976.1.56320 WP_000741976.1.57732 WP_000741976.1.58822 WP_000741976.1.59058 WP_000741976.1.59997 WP_000741976.1.63789 WP_000741976.1.63902 WP_000741976.1.64282 WP_000741976.1.64568 WP_000741976.1.65803 WP_000741976.1.67001 WP_000741976.1.67912 WP_000741976.1.74863 WP_000741976.1.7593 WP_000741976.1.76086 WP_000741976.1.76155 WP_000741976.1.76902 WP_000741976.1.80649 WP_000741976.1.85348 WP_000741976.1.86637 WP_000741976.1.87768 WP_000741976.1.88154 WP_000741976.1.88200 WP_000741976.1.93683 WP_000741976.1.97262 WP_000741976.1.97842 WP_000741976.1.98604 gi|218234497|ref|YP_002366780.1| gi|30020193|ref|NP_831824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]