SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 227377.CBU_0727 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227377.CBU_0727
Domain Number 1 Region: 11-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000785
Family Anti-sigma factor antagonist SpoIIaa 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 227377.CBU_0727
Sequence length 377
Comment (Coxiella burnetii)
Sequence
MPIVQNGVASIEVSSDQQELFCLGDWTVSHLSPLEDQLPLYAEKLSEKVIIHADKITKMD
SAGALLFYTLINHLKSLGKAIEITGLSENAQSLLKLIGNESKFLRQPLPSSKTPGVVYLL
GEWAVTKWRVLIDFLTFVGEVATTAGQGILKPQRIQWRAILRAIEETGYQALPIVALLSF
LVGVVLTYQIALQLDSYNADIFVVDITGAAILREFGPLITAIIAAGRTSTAFTAQIGTMK
VNEEIDALNTMGVVPIEHLVLPKIIALIISLTLLTVWADIFGTFGSMIMAKSQLDIGYLA
FLDRFHHAIAVRHYIAGLIKAPVFGLIIATVGCFQGFQVGASADSVGQKTTQSAVQSIFL
IIIADAIFSVIFSLRGI
Download sequence
Identical sequences A0A2K2ECP9 Q83DK3
gi|161830426|ref|YP_001596961.1| gi|29654061|ref|NP_819753.1| NP_819753.1.72601 WP_005772900.1.11896 WP_005772900.1.15899 WP_005772900.1.18645 WP_005772900.1.20088 WP_005772900.1.31144 WP_005772900.1.38839 WP_005772900.1.39746 WP_005772900.1.41753 WP_005772900.1.44545 WP_005772900.1.460 WP_005772900.1.513 WP_005772900.1.53098 WP_005772900.1.55037 WP_005772900.1.55635 WP_005772900.1.56161 WP_005772900.1.57074 WP_005772900.1.6787 WP_005772900.1.68745 WP_005772900.1.68840 WP_005772900.1.72017 WP_005772900.1.7296 WP_005772900.1.73073 WP_005772900.1.74283 WP_005772900.1.88235 WP_005772900.1.8942 WP_005772900.1.92481 WP_005772900.1.96664 WP_005772900.1.9866 gi|212212807|ref|YP_002303743.1| 227377.CBU_0727 360115.COXBURSA331_A1224 434923.CbuG_1276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]