SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 227377.CBU_1483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227377.CBU_1483
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.52e-28
Family Clp protease, ClpP subunit 0.09
Further Details:      
 
Domain Number 2 Region: 391-456
Classification Level Classification E-value
Superfamily NfeD domain-like 2.48e-16
Family NfeD domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 227377.CBU_1483
Sequence length 458
Comment (Coxiella burnetii)
Sequence
MYCRKRIFIRCFYILMLTFGLLGIASHIIAQNNTRRLAILIDIKGGIGPATADFFHRSLK
QATEKKAQVIILQLDTPGGLVTAMRDIIKDILASPIPVIGYVAPSGAHAASAGTYILYAT
HIAAMAPGTNLGAATPIAIGTPGGSSPEKGNEKKEGAKKAPAQKTAAEKKAISDARAYIR
SLAQLRGRNVEWAESAVDEAESLSAEEAYKIKVINIIASNIPNLLEQANGMKISVRGETQ
TVNTANLEIEKVEPDWRTRFLSVITDSSVAYILLMIGFYGIFFEFINPGFIVPGVVGAIS
LLLALYAFQLLPINYAGLALILLGLAFIVAEAFMPSFGMLGIGGGVAFVIGSIMLMRTDA
IGFGIPMYLIIAIAIVTIAFFLLVLSIAFRSRGRPIVSGREAVIGKRGVVNVSDKRMWVR
IEGERWQCKSDVPLQDGDEVVVERLEGLFCVVKPVEKK
Download sequence
Identical sequences Q83BM1
227377.CBU_1483 gi|29654774|ref|NP_820466.1| NP_820466.1.72601 WP_010958257.1.15899 WP_010958257.1.39746 WP_010958257.1.53098 WP_010958257.1.55635 WP_010958257.1.56161 WP_010958257.1.68745 WP_010958257.1.88235 WP_010958257.1.8942 WP_010958257.1.92481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]