SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 227882.SAV_5799 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227882.SAV_5799
Domain Number 1 Region: 62-232
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.33e-37
Family Voltage-gated potassium channels 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 227882.SAV_5799
Sequence length 275
Comment (Streptomyces avermitilis)
Sequence
MDVRGSRGGWAAGSPRPLRGALGTYDAGMKEQSAQARWEQHTQRPLLALAVAFAVAYAVP
IVDSDASRSLTGVCTAVEWVVWGSFAADYLVRLAITAERREFVRTHWLDLCAVVLPILQP
LRLLRLVSTLMLLGRRARMASQIRLTTYVAGSVIGLLMFGSLAVLSVERDSPNGNIRTLG
DAVWWSFTTMTTVGYGDHAPTTGLGRMIAVGLMLSGIALLGVVTANIATWFISRFEKDDV
EERRQTAAIEALTEEVRALRAEVAALSGAAEKQPR
Download sequence
Identical sequences Q82BA6
gi|29832342|ref|NP_826976.1| 227882.SAV_5799 GO.9054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]