SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 227882.SAV_6481 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227882.SAV_6481
Domain Number 1 Region: 75-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000536
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 227882.SAV_6481
Sequence length 143
Comment (Streptomyces avermitilis)
Sequence
MNDIEAWVWWLVGAVALGIPLVVTAMPEFGMLALGAAAAAVTAGVGGGVVLQVLVFAVVS
VALLAVVRPIAARHRAQRPQLATGIDALKGKQAVVLERVDGAGGRIKLAGEVWSARSLDS
GRAYEVGQEVDVVDIEGATAIVI
Download sequence
Identical sequences Q829D0
227882.SAV_6481 gi|29833023|ref|NP_827657.1| WP_010987881.1.19017 WP_010987881.1.30226 WP_010987881.1.49792 WP_010987881.1.60620 WP_010987881.1.68722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]