SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 227882.SAV_921 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227882.SAV_921
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 227882.SAV_921
Sequence length 139
Comment (Streptomyces avermitilis)
Sequence
MTDMSPLTITTRDAPTGPVLEITGDLDHETSPELRHAIDRLTLARGQLLVLDLAGLRFCD
SSGITLLLAARNLAIEAGVDTVLAAVPANTARVLGIVGLDQVFAFYPDTRAATAAHPPTA
VIADTTPRGTGSRADQVES
Download sequence
Identical sequences Q82PI1
gi|29827462|ref|NP_822096.1| 227882.SAV_921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]