SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 227941.CCA00233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227941.CCA00233
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.26e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 227941.CCA00233
Sequence length 116
Comment (Chlamydophila caviae)
Sequence
MNNIQKEEHGTTAVLHLQGKLDGISSPEVQENISQSLSSGIKNIVLDCTNLDYMSSAGIR
VLLQSYHQVGKHSGKIVLTCVPKTVEQTLYVTGFLSYFKMFNSVQEALQALSKDED
Download sequence
Identical sequences Q824C0
WP_011006202.1.7641 gi|29840000|ref|NP_829106.1| 227941.CCA00233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]