SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 227941.CCA00413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227941.CCA00413
Domain Number 1 Region: 207-308
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.00000000323
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.044
Further Details:      
 
Weak hits

Sequence:  227941.CCA00413
Domain Number - Region: 50-200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0223
Family Extended AAA-ATPase domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 227941.CCA00413
Sequence length 311
Comment (Chlamydophila caviae)
Sequence
MQEHTCFQDFSKFYKEKAPALTVIGSNSEEDKSVCMELLVSGKTQEFDASGLTISDLSKW
TESYGLFASKEVISIFQAEKLSQQTRDFLIRYARNPRPHLIVFLFTTKQSCFQSLRKELS
SAAFLSLFGEWQSDREKRMTVLLSQRAALLGVTCSLALASAFIKKFPLGEMHNLIGEFHK
LLCCIGKKQALEYSDIESFVVKKEQVSLWKLRDAILQRNTAESQALLRALLLEHGEDPLG
LIAFLRGQCLYGLRSLEKETADRKHRFFIAYGKERLHQALSHLFYAESIIKNNVQDSIIA
VETLLIRMTNS
Download sequence
Identical sequences Q823J7
227941.CCA00413 WP_011006375.1.7641 gi|29840175|ref|NP_829281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]