SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 228400.HSM_1611 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228400.HSM_1611
Domain Number 1 Region: 109-315
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.45e-49
Family D-glucarate dehydratase-like 0.000000346
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.88e-28
Family Enolase N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 228400.HSM_1611
Sequence length 332
Comment (Haemophilus somnus 2336)
Sequence
MTNRTFHLYQYAIPVDSQLILRNRFLKKREGLFVQIKCGEHEGWGEIAPLPEFSQETLEQ
AKEQTVQWLKKWEQARSANQKFSLQGLYPSVAFGLSCALAEMEGELVQEGNYQVAPLCYG
DPDELYDVLNQIPGEKVAKIKVGMYEANRDGMIADMLLEAIPDLYLRLDANRSWTLSKAQ
LFAKYVKPEHRKRIQFLEEPCKTQDDSRQFAQDTGIALAWDESIREQGFKLEKEPHLAAI
VIKPTLIGSLQDCVKLIEKAHQLGLKAVISSSIESSLGLTQLARIAKQYTPNVTPGLDTL
SLMDYQILRSWQGSDLPLLDLSSEFIKKIEIE
Download sequence
Identical sequences B0UV87
gi|170717876|ref|YP_001784931.1| WP_012340741.1.3141 WP_012340741.1.31663 WP_012340741.1.32721 WP_012340741.1.4486 WP_012340741.1.51051 WP_012340741.1.71281 WP_012340741.1.72297 WP_012340741.1.80424 WP_012340741.1.8746 WP_012340741.1.92579 228400.HSM_1611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]