SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 228405.HNE_1054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228405.HNE_1054
Domain Number 1 Region: 93-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000523
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 228405.HNE_1054
Sequence length 154
Comment (Hyphomonas neptunium ATCC 15444)
Sequence
MEILLSELTWWHWVALGLVLFGIEMMTGTFDLLMISIAAILTALFAGLAPDGLAGWQGQM
AVFGIAAVVLVAGGRMFLSRRGPPPEHPTLNKRMAGLVGQHGQATKDFVAGSGQVQIGDT
VWGAEAVPGEPPILAGDTVTVSATDGNTAIVRKG
Download sequence
Identical sequences A0A059FZE3 Q0C3B7
WP_011646076.1.33885 WP_011646076.1.6977 228405.HNE_1054 gi|114799456|ref|YP_759776.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]