SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228405.HNE_1940 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228405.HNE_1940
Domain Number 1 Region: 104-311
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.71e-19
Family D-aminoacid oxidase, N-terminal domain 0.0054
Further Details:      
 
Weak hits

Sequence:  228405.HNE_1940
Domain Number - Region: 298-366
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00183
Family D-aminoacid oxidase-like 0.011
Further Details:      
 
Domain Number - Region: 44-98
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00247
Family D-aminoacid oxidase, N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 228405.HNE_1940
Sequence length 377
Comment (Hyphomonas neptunium ATCC 15444)
Sequence
MPELARRSVLLGLGASALTACVSQPAAMAPPPAARTFPKVLSQRDRITRTVVGLRPFRPQ
GFRLEAERFGDKTVIHNYGHGGCGVTLSWGTCQRAAVMAGETGRQDVAILGGGVMGLTSA
LILARRGHDVTVYADVMHPNTTSNIAGALWLPSSLFDRDVASEEFLRLNWQVTREAHRGF
LPYVNRPGYGVSWVRHSEVSPRVREPRWALPGGDDLYPDLDVRTTETRFGFAYEERYNTL
MIDPDYYLDMLMKDGQLAGARFVARRFESLEEVLALPQPVIVNCTGLGAAKLFGDETLMP
IRGQLSHLLPQPEVDYSYTASGQGGVLYMFPRKTGLVLGGSHGRGDASMDISEAELTRMV
DGHAALAERASFVTFAG
Download sequence
Identical sequences A0A059FWV5 Q0C0V2
WP_011646941.1.33885 WP_011646941.1.6977 gi|114797607|ref|YP_760641.1| 228405.HNE_1940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]