SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228410.NE0493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228410.NE0493
Domain Number 1 Region: 55-101
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000317
Family Excisionase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 228410.NE0493
Sequence length 105
Comment (Nitrosomonas europaea)
Sequence
MMSHTLTAEELYAEIKRMPIAERIRFFSLLADSAFREDDFTHEQIFGETYQEPFSAPEAA
EYLEISLPTLRRYVQSGKLVPSCIVGRNQMFSAQTLRTFKRNRGN
Download sequence
Identical sequences Q82X07
228410.NE0493 gi|30248508|ref|NP_840578.1| WP_011111124.1.11244 WP_011111124.1.14462 WP_011111124.1.55826 WP_011111124.1.61914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]