SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 228410.NE2468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228410.NE2468
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.66e-22
Family Clp protease, ClpP subunit 0.05
Further Details:      
 
Domain Number 2 Region: 343-406
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000222
Family NfeD domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 228410.NE2468
Sequence length 417
Comment (Nitrosomonas europaea)
Sequence
MQDYIQRGLSRATERRAQVIILQIDTPGGLDVSMRKIIQEIIASPVPVVSFVAPGGARAA
SAGTYILYASHIAAMAPATNLGAATPVKMNTLASKPEVPDSQPKGEQPDKSDSQDAMTVK
VINDAVAYIRGLAQMRGRNADWAEQAVREGVSLTAAEALDKNVIDLVADDVSDLLARIDG
RTVDLSGEKVKLSTRSLALERIEQDWRTRLLAVVADPNIAYILMLIGFYGLVLEFTTPGT
IVAGVVGAISLLLALFAFQVLPINYAGLALILLGITFMLAEALLPGVGALGIGGIAAFVI
GSIMLIDTEVPDYGISIPLIATFTLMSAGFFMLVFGMVLKSRKKPVVSGSEELVHSTGEV
LESFDQEGWVRVHGERWRARTNTPLSPGQRIKVTAMRGLLLEVEPCQPDHTMNATEN
Download sequence
Identical sequences A0A1I0E264 Q82S85
228410.NE2468 WP_011112931.1.11244 WP_011112931.1.14462 WP_011112931.1.55826 WP_011112931.1.61914 gi|30250389|ref|NP_842459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]