SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 232721.Ajs_4008 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  232721.Ajs_4008
Domain Number 1 Region: 768-1020
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0079
Further Details:      
 
Domain Number 2 Region: 29-205
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.12e-20
Family Pyruvate oxidase and decarboxylase Pyr module 0.065
Further Details:      
 
Domain Number 3 Region: 463-572,606-666
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000964
Family PFOR PP module 0.057
Further Details:      
 
Weak hits

Sequence:  232721.Ajs_4008
Domain Number - Region: 286-371
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0228
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 232721.Ajs_4008
Sequence length 1206
Comment (Acidovorax JS42)
Sequence
MNAPLPEHVRRALETVTLEDKYTLGHGRAFMSGVQALVRLPMLQRQRDAAVGLNTAGFVS
GYRGSPLGGYDQALWGARKHLAEHHVVFQPGVNEELAATAVWGTQQLDIYPQSKKYDGVF
GIWYGKGPGVDRCSDVFKHANMAGTARHGGVIAVAGDDHISKSSTAAHQSDHIFKACGLP
VFFPSSVQDILDMGLHAFALSRFSGLWSGLKTIQEVVESSSSISVDPDRVKIVMPEDFTM
PPGGLHIRWPDAPLEQEARLMDYKWYAALAYIRANKLNYNVIQGPQDRFGIIASGKAYND
TRQALVDLGLDDDTCRQLGIRVHKVNVVWPLEATITRDFAQGLQEILVVEEKRQVIEYQI
KEELYNWRADVRPNVLGKFDEIEGDNSGGEWSMPNPSQNWLLRPKADLTPAIIAKAIAKR
LKKLGVPEDIVARMDARISVVEARERGLLEVKTDTGERMPWFCSGCPHNTSTRVPEGSRA
VAGIGCHYMANWMPDRATSTFTQMGGEGVTWVGQAPFTKDKHVFANLGDGTYFHSGLLAI
RQSIASGANITYKILYNDAVAMTGGQQVGERPEGHSVAQIAHSLRAEGVVRLAVVTDEPE
KYHGRTHPANAARAGHPELLNDLPPGVEVFHRDELDRIQREFREIAGCTAIIYDQTCATE
KRRRRKRGLLATPAKTVVINELVCEGCGDCSVQSNCLSVEPVETEFGRKRRINQSTCNKD
YSCVKGFCPSFVTVEGGQLKKPKKEKKGDLSTMAPIPEPVLPAAEAAWGIVVAGVGGTGV
ITIGSLLGMAAHLEGKGVITQDAAGLAQKGGSTWSHVQIANRPEAIHTTKVDTAKADLVI
GCDPIVAANKATLAAMQPGRTFVALNSHGTPAAAFVHNPNWQFPADGCEAAIAQAVGAEL
LGVFDAEQVASQLLGDSIYTNPLMLGYAWQKGRVPLSHAALMRAMELNGVQVENNKAAFE
WGRRCAHNLAEVQALFQAAQVIQFVKKPGLAEMVAKRVDFLTGYQNAAYAAEYQAFVDKV
RAAEDSLGQGTRLTEAVARYLFKLMAYKDEYEVARLHTDKAFTDKIAAMYEGDYKLVHHL
APPLLAKHNDKGELVKQSYGPWMRKAFGVLVRMKGLRGTALDVFGRTEERKTERALIREY
RACIEELLKGLTAERLALAVEIARIPEDIRGYGHVKERHLQAARKKWFALMDRWRAPHAG
APRQVA
Download sequence
Identical sequences A1WCY7
gi|121596292|ref|YP_988188.1| 232721.Ajs_4008 WP_011807091.1.39107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]