SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 233150.MGA_0069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  233150.MGA_0069
Domain Number - Region: 45-166
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0118
Family Enolase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 233150.MGA_0069
Sequence length 682
Comment (Mycoplasma gallisepticum)
Sequence
MKRKNILKFVSLLGIGSFVMLAAASCTTSVNPTPNPTPELKPDPMPNPPSGGMNGGDTNP
GNGGGMDNSAQQLAAARTALTSLLASKNANVEMYSDYAKIKNDLTAAYTTAKSTSDNTSA
TLEQVKSATSTLQTAIDAAASEKKTFDASNPELIKFYNNLKTELQSKTTNLESLNDPQYS
GIKDNLNSLYNSASEIVNKTLIPATGNDLMRTDVEKVNTELMGAVSSLAARKTSAENLFS
AFDKNVLVKTNLTAGNDSQVANDQPGNYSFVAFSVNAVTASDNLPNWNFAQRRVWDSATA
PLATTTTENGAQPEPALTDVSWIYNLTGTGAKYSFTFNYFGPRTGYLYFPYKLVNSSQSD
KVGLQYKLNEGSVQAITFAPTTPASAVSEPTHTPTEMASSNEMSVANNDMAVVKEANPTP
TVNDIKVAKVSLSNLNFGENTIEFSVPSGDGIVAPMIGNMYLTSNPANTDKIYNSIFGNS
IADNNTITVDLLKGYSLSTSYSIYIRRFTGLQEAHTTDPVYLVGWIGGNGARKNDPSIQN
VNSFPVVNNQDRVFTIYVNAPTAGEYNISGSYISTTSARSLNFLRSNGTSNNSVTISVTA
KTDWTTLGTFDTASNTTTTTSRPTNSKKTLNLQKGLNKIVISGVANGNTPYIGNLTFTLN
TTTQENAEHSTSEAPASSQPKQ
Download sequence
Identical sequences Q7NB56
gi|385325533|ref|YP_005879971.1| gi|31544628|ref|NP_853206.1| WP_011113671.1.10884 WP_011113671.1.30373 WP_011113671.1.56312 233150.MGA_0069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]