SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 233412.HD0304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  233412.HD0304
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.04e-17
Family Short-chain ferredoxins 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 233412.HD0304
Sequence length 86
Comment (Haemophilus ducreyi 35000HP)
Sequence
MALLITHKCTNCDMCLPECPNEAISIGDDVYVIDPILCTECVGHYEKPTCQKVCPITNCI
IADPDHRESQDELWEKFVMIHHPDKL
Download sequence
Identical sequences A0A0H4GXW9 Q7VP07
gi|33151541|ref|NP_872894.1| 233412.HD0304 WP_010944336.1.16260 WP_010944336.1.19709 WP_010944336.1.19715 WP_010944336.1.2534 WP_010944336.1.34146 WP_010944336.1.41579 WP_010944336.1.45441 WP_010944336.1.69448 WP_010944336.1.70288 WP_010944336.1.70555 WP_010944336.1.77494 WP_010944336.1.78970 WP_010944336.1.79704 WP_010944336.1.84729 WP_010944336.1.91697 WP_010944336.1.99406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]