SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_0166 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  234267.Acid_0166
Domain Number - Region: 4-122
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000471
Family Sfri0576-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_0166
Sequence length 144
Comment (Solibacter usitatus Ellin6076)
Sequence
MPITYQIDRRAAFIRTRCFGNVTLEEVRDHFRQLVKEPDLPQFLDVFLDLRDMASSPSAG
QIREAGNTIARLPPAVRFGACAIVAQRDAIYGISRMFSVFVEPFFTAISAFRSASEAETW
LRAHHSKEMAAAATSPKGPWADFL
Download sequence
Identical sequences Q02CN6
234267.Acid_0166 WP_011681956.1.46729 gi|116619309|ref|YP_821465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]