SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_2057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_2057
Domain Number 1 Region: 115-367
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.75e-57
Family D-glucarate dehydratase-like 0.00017
Further Details:      
 
Domain Number 2 Region: 8-128
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.09e-27
Family Enolase N-terminal domain-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_2057
Sequence length 372
Comment (Solibacter usitatus Ellin6076)
Sequence
MEPASAPKVERLEVSAYTVPTETPESDGTIAWSETTLVMVRMAACGAEGLGYTFADVATA
ALIDAHLKDAVVGHNPLNIPELWSTMVRKVRNLGRPGVCSMAISAVDNALWDLKARLLHL
SVADLLGRAHDSIGAYGSGGFTSYSDEELRQQLTGWIGQGLTQVKMKIGSDPASDLARVR
SARGAIGPDAELFVDANGAYDRKQALAKAAAFADLGVSWFEEPVSSDDLAGLRLIRERAP
AGMRIAAGEYGYDSFYFRRMLEAEAVDVLQGDATRCAGITGFLAAGNLSTSFSTPFSAHT
APSLHAHAACALTSAINVEYFFDHYRIEQMFFDGALVPSNGVLRPDSTRPGFGLECKLSD
MEKYRVYGNVTT
Download sequence
Identical sequences Q026M2
WP_011683820.1.46729 234267.Acid_2057 gi|116621176|ref|YP_823332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]