SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_2984 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_2984
Domain Number 1 Region: 156-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.06e-68
Family D-glucarate dehydratase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 56-170
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.21e-30
Family Enolase N-terminal domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_2984
Sequence length 443
Comment (Solibacter usitatus Ellin6076)
Sequence
MKRRQFLAGVGTMAGGKLMGSPEGRPSLSFCDCAMQPQFAMPPGASTLAAVGSKVRITNL
KTFGVTIPGAPADRPYVFVKLETNAGLVGWGEGTLEGKAGSVMACINDFHDFLIGADPMP
VEHHWQSMYVHSFYRAGPVIGSAISAIDQALWDLRGKILGVPVYKLLGGPNDPEGVRGYY
VANARSLDDLKRLRETAQSQGITAFKGGLPDYYEWIETSAKITEAIRHVEMLREGLGPDI
DIAVDFHAKTSPTVASVIIKELDPLELLWVEEPCPPENAWAMGRIAKRVRTPIATGERLV
AAHGVREIVEQAVVDIIQTDANHVGGITALWKVAAMADLSSISMAPHACEGPIGMLASLH
VDASIPNFLIQECCGQAVPQTRDKVWEEWFGFPAMRMVNGKYPLPDKPGLGFELTEDALK
KYPFAGTRPMTRVFHKDGSVAEW
Download sequence
Identical sequences Q01NB8
gi|116622097|ref|YP_824253.1| 234267.Acid_2984 WP_011684732.1.46729 NYSGXRC-9815b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]