SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_3343 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_3343
Domain Number 1 Region: 137-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.3e-67
Family D-glucarate dehydratase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 47-149
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.19e-19
Family Enolase N-terminal domain-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_3343
Sequence length 450
Comment (Solibacter usitatus Ellin6076)
Sequence
MPLDRTRPARRSFLKGTAAALGLGFGVDNVLEALPQNVNTNSRPSELKITDLRVAVVSRA
PMTCPIIRIDTNQGIYGLGEVRDGASKNYALMLKSRLLNENPCNVDKLFRKIKQFGGHAR
QGGGVCGVEMALWDLAGKAYNVPVHQMLGGKFRDRIRCYADTTESHDPKVYGQRLKARRD
EGFTWLKMDLGVDLVADVPGALTMPVGERINGNPMVAHMFTGNEITEKGIQLMCDYVAQI
REIVGMDIPLSADHFGHIGVNSCIRLGKALTKYNMAWLEDMIPWQQTALLKQIADAVDIP
ILTGEDIYLKEPFIELCKAHAVDIIHPDLATSGGILETKKIGDAAQELGVAMAMHFAGSP
VSCMANVHCAAATENFLVLENHSVDVPWWGDLVEGVSKPIVSKGFITVPNGPGLGVTLND
EVVKQHLGEPGYFEATPYWNVDRSNDRQWS
Download sequence
Identical sequences Q021Q9
NYSGXRC-9238a gi|116622445|ref|YP_824601.1| WP_011685077.1.46729 234267.Acid_3343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]