SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_5534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_5534
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily GlnB-like 4.45e-41
Family Prokaryotic signal transducing protein 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_5534
Sequence length 112
Comment (Solibacter usitatus Ellin6076)
Sequence
MKKIEAIIQPFKMDEVKEALMGIGIEGITISEVRGHGRQKGHKEVYRGQEYNVDLLPKLK
MEMVVASDRSDEVIKVLAGAARTGKIGDGKIFIYDVAEAIRIRNGDRGDLAL
Download sequence
Identical sequences Q01V34
gi|116624610|ref|YP_826766.1| 234267.Acid_5534 WP_011687220.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]